Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   ABFV68_RS14600 Genome accession   NZ_CP156029
Coordinates   2997367..2997507 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain CH1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2992367..3002507
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ABFV68_RS14575 (ABFV68_14575) - 2992681..2993064 (-) 384 WP_007408674.1 hotdog fold thioesterase -
  ABFV68_RS14580 (ABFV68_14580) comA 2993086..2993730 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  ABFV68_RS14585 (ABFV68_14585) comP 2993811..2996117 (-) 2307 WP_041482505.1 histidine kinase Regulator
  ABFV68_RS14590 (ABFV68_14590) comX 2996140..2996310 (-) 171 WP_015418105.1 competence pheromone ComX -
  ABFV68_RS14595 (ABFV68_14595) - 2996307..2997236 (-) 930 WP_231945405.1 polyprenyl synthetase family protein -
  ABFV68_RS14600 (ABFV68_14600) degQ 2997367..2997507 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  ABFV68_RS14605 (ABFV68_14605) - 2997970..2998311 (+) 342 WP_007408677.1 hypothetical protein -
  ABFV68_RS14610 (ABFV68_14610) - 2998318..2999541 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  ABFV68_RS14615 (ABFV68_14615) - 2999671..3001137 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  ABFV68_RS14620 (ABFV68_14620) - 3001155..3001706 (-) 552 WP_003152033.1 isochorismatase family cysteine hydrolase -
  ABFV68_RS14625 (ABFV68_14625) - 3001803..3002201 (-) 399 WP_020956272.1 DUF1694 domain-containing protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=1001405 ABFV68_RS14600 WP_003152043.1 2997367..2997507(-) (degQ) [Bacillus velezensis strain CH1]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=1001405 ABFV68_RS14600 WP_003152043.1 2997367..2997507(-) (degQ) [Bacillus velezensis strain CH1]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment