Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 200001 |
| Name | oriT_Tn916  |
| Organism | Enterococcus faecalis DS16 |
| Sequence Completeness | intact |
| NCBI accession of oriT (coordinates [strand]) | U09422 (2441..2656 [+], 216 nt) |
| oriT length | 216 nt |
| IRs (inverted repeats) | 61..76, 80..95 (ACTTAACCCCCCGTAT..ACAGGGGGGTACAAAT) 123..134, 139..150 (GAAAATCCTTTG..CAAGGGATTTAC) |
| Location of nic site | 135..136 |
| Conserved sequence flanking the nic site |
TGG|T |
| Note | _ |
oriT sequence
Download Length: 216 nt
AAGCGGAAGTCGCAGGTGTGGACTGATCTTGCTGGCTGGTGTGGCAATAGCCACGCCAGCACTTAACCCCCCGTATCTAACAGGGGGGTACAAATCGACAGGAAACAGTCAAAAAAACATTAGAAAATCCTTTGGTTACAAGGGATTTACAAAATTTCAGCGTATGTCAAATGGGCTTTAAAAGTTGACATACGGCCTTTTTGATTGGAGGGATTT
Visualization of oriT structure (The oriT was characterized experimentally)
oriT secondary structure
Predicted by RNAfold.
Download structure file
Reference
[1] Roberts AP et al. (2009) A modular master on the move: the Tn916 family of mobile genetic elements. Trends Microbiol. 17(6):251-8. [PMID:19464182]
[2] Rocco JM et al. (2006) The integrase of the conjugative transposon Tn916 directs strand- and sequence-specific cleavage of the origin of conjugal transfer, oriT, by the endonuclease Orf20. J Bacteriol. 188(6):2207-13. [PMID:16513750]
[3] Roberts AP et al. (2001) Comparison of Tn5397 from Clostridium difficile, Tn916 from Enterococcus faecalis and the CW459tet(M) element from Clostridium perfringens shows that they have similar conjugation regions but different insertion and excision modules. Microbiology. 147(Pt 5):1243-51. [PMID:11320127]
[4] Jaworski DD et al. (1995) A functional origin of transfer (oriT) on the conjugative transposon Tn916. J Bacteriol. 177(22):6644-51. [PMID:7592445]
Relaxosome
This oriT is a component of a relaxosome.
| Relaxosome name | RelaxosomeTn916  |
| oriT | oriT_Tn916 |
| Relaxase | Orf20_Tn916 (MOBT) |
| Auxiliary protein | Int_Tn916 |
Reference
[1] Roberts AP et al. (2009) A modular master on the move: the Tn916 family of mobile genetic elements. Trends Microbiol. 17(6):251-8. [PMID:19464182]
[2] Rocco JM et al. (2006) The integrase of the conjugative transposon Tn916 directs strand- and sequence-specific cleavage of the origin of conjugal transfer, oriT, by the endonuclease Orf20. J Bacteriol. 188(6):2207-13. [PMID:16513750]
[3] Roberts AP et al. (2001) Comparison of Tn5397 from Clostridium difficile, Tn916 from Enterococcus faecalis and the CW459tet(M) element from Clostridium perfringens shows that they have similar conjugation regions but different insertion and excision modules. Microbiology. 147(Pt 5):1243-51. [PMID:11320127]
[4] Jaworski DD et al. (1995) A functional origin of transfer (oriT) on the conjugative transposon Tn916. J Bacteriol. 177(22):6644-51. [PMID:7592445]
Relaxase
| ID | 215 | GenBank | AAB60013 |
| Name | Orf20_Tn916 |
UniProt ID | Q47728 |
| Length | 329 a.a. | PDB ID | |
| Note | Endonuclease | ||
Relaxase protein sequence
Download Length: 329 a.a. Molecular weight: 39099.72 Da Isoelectric Point: 7.0754
MLFDYVRIRFPTTDVQQVVENILQLKLSYFLHEDYGFYSYSEHYALGDIFVLCSHELDKGVLVELKGRGC
RQFESYLLAQQRSWYEFFMDVLVAGGVMKRLDLAINDKTGILNIPVLTEKCQQEECISVFRSFKSYRSGE
LVRKEEKECMGNTLYIGSLQSEVYFCIYEKDYEQYKKNDIPIEDAEVKNRFEIRLKNERAYYAVRDLLVY
DNPEHTAFKIINRYIRFVDKDDSKPRSDWKLNEEWAWFIGNNRERLKLTTKPEPYSFQRTLNWLSHQVAP
TLKVAIKLDEINQTQVVKDILDHAKLTDRHKQILKQQSVKEQDVITTKK
Protein domains
Predicted by InterproScan.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q47728 |
Reference
[1] Rocco JM et al. (2006) The integrase of the conjugative transposon Tn916 directs strand- and sequence-specific cleavage of the origin of conjugal transfer, oriT, by the endonuclease Orf20. J Bacteriol. 188(6):2207-13. [PMID:16513750]
Auxiliary protein
| ID | 303 | GenBank | AAB60030 |
| Name | Int_Tn916 |
UniProt ID | P22886 |
| Length | 405 a.a. | PDB ID | 1B69, 1BB8, 1TN9, 2BB8 |
| Note | Int apparently plays a dual role in the movement of the transposon from the donor to the recipient. Integrase;Accessory protein | ||
Auxiliary protein sequence
Download Length: 405 a.a. Molecular weight: 47049.93 Da Isoelectric Point: 9.8019
MSEKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKD
IHDGIDVVGKKMTLCQLYAKQNAQRPKVRKNTETGRKYLMDILKKDKLGVRSIDSIKPSDAKEWAIRMSE
NGYAYQTINNYKRSLKASFYIAIQDDCVRKNPFDFQLKAVLDDDTVPKTVLTEEQEEKLLAFAKADKTYS
KNYDEILILLKTGLRISEFGGLTLPDLDFENRLVNIDHQLLRDTEIGYYIETPKTKSGERQVPMVEEAYQ
AFKRVLANRKNDKRVEIDGYSDFLFLNRKNYPKVASDYNGMMKGLVKKYNKYNEDKLPHITPHSLRHTFC
TNYANAGMNPKALQYIMGHANIAMTLNYYAHATFDSAMAEMKRLNKEKQQERLVA
Protein domains
Predicted by InterproScan.
Protein structure
| Source | ID | Structure |
|---|---|---|
| PDB | 1B69 | |
| PDB | 1BB8 | |
| PDB | 1TN9 | |
| PDB | 2BB8 | |
| AlphaFold DB | P22886 |
Reference
[1] Rocco JM et al. (2006) The integrase of the conjugative transposon Tn916 directs strand- and sequence-specific cleavage of the origin of conjugal transfer, oriT, by the endonuclease Orf20. J Bacteriol. 188(6):2207-13. [PMID:16513750]
T4CP
| ID | 215 | GenBank | AAB60012 |
| Name | Orf21_Tn916 |
UniProt ID | Q47727 |
| Length | 461 a.a. | PDB ID | _ |
| Note | The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. | ||
T4CP protein sequence
Download Length: 461 a.a. Molecular weight: 53370.27 Da Isoelectric Point: 9.0687
MKQRGKRIRPSGKDLVFHFTIASLLPVFLLVVGLFHVKTIQQINWQDFNLSQADKIDIPYLIISFSVAIL
ICLLVAFVFKRVRYDTVKQLYHRQKLAKMILENKWYESEQVKTEGFFKDSAGRTKEKITYFPKMYYRLKN
GLIQIRVEITLGKYQDQLLHLEKKLESGLYCELTDKELKDSYVEYTLLYDTIASRISIDEVEAKDGKLRL
MKNVWWEYDKLPHMLIAGGTGGGKTYFILTLIEALLHTDSKLYILDPKNADLADLGSVMANVYYRKEDLL
SCIETFYEEMMKRSEEMKQMKNYKTGKNYAYLGLPAHFLIFDEYVAFMEMLGTKENTAVMNKLKQIVMLG
RQAGFFLILACQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGSDVQKDFFLKRIKGRGYVDVGTSV
ISEFYTPLVPKGYDFLEEIKKLSNSRQSTQATCEAEVAGVD
Protein domains
Predicted by InterproScan.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q47727 |
Reference
[1] Rocco JM et al. (2006) The integrase of the conjugative transposon Tn916 directs strand- and sequence-specific cleavage of the origin of conjugal transfer, oriT, by the endonuclease Orf20. J Bacteriol. 188(6):2207-13. [PMID:16513750]
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 336..11746
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| Locus_0 | 194..313 | + | 120 | AAB60009 | - | - |
| Locus_1 | 336..650 | + | 315 | AAB60010 | - | orf23 |
| Locus_2 | 666..1052 | + | 387 | AAB60011 | - | orf23 |
| Locus_3 | 1081..2466 | + | 1386 | AAB60012 | - | virb4 |
| Locus_4 | 2861..3850 | + | 990 | AAB60013 | - | - |
| Locus_5 | 3893..4114 | + | 222 | AAB60014 | - | orf19 |
| Locus_6 | 4231..4728 | + | 498 | AAB60015 | - | - |
| Locus_7 | 4703..5209 | + | 507 | AAB60016 | - | orf17a |
| Locus_8 | 5193..7640 | + | 2448 | AAB60017 | - | virb4 |
| Locus_9 | 7643..9907 | + | 2265 | AAB60018 | - | orf15 |
| Locus_10 | 9816..10817 | + | 1002 | AAB60019 | - | orf14 |
| Locus_11 | 10814..11746 | + | 933 | AAB60020 | - | orf13 |
| Locus_12 | 12021..12107 | + | 87 | AAB60021 | tet(M) leader peptide | - |
| Locus_13 | 12123..14042 | + | 1920 | AAB60022 | - | - |
| Locus_14 | 14140..14328 | + | 189 | AAB60023 | - | - |
| Locus_15 | 14388..14741 | - | 354 | AAB60024 | - | - |
| Locus_16 | 14946..15017 | + | 72 | AAB60025 | - | - |
| Locus_17 | 15195..15668 | + | 474 | AAB60026 | - | - |
| Locus_18 | 15665..15895 | + | 231 | AAB60027 | - | - |
| Locus_19 | 16121..16372 | - | 252 | AAB60028 | - | - |
| Locus_20 | 16356..16559 | + | 204 | AAB60029 | - | - |
Host bacterium
| ID | 6 | Element type | ICE (Integrative and conjugative element) |
| Element name | Tn916 | GenBank | U09422 |
| Element size | 18032 bp | Coordinate of oriT [Strand] | 2441..2656 [+] |
| Host bacterium | Enterococcus faecalis DS16 |
Cargo genes
| Drug resistance gene | tet(M) |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |