Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 100181 |
Name | oriT_ColE1 |
Organism | Escherichia coli |
Sequence Completeness | core |
NCBI accession of oriT (coordinates [strand]) | NC_001371 (1462..1521 [-], 60 nt) |
oriT length | 60 nt |
IRs (inverted repeats) | 3..12, 16..25 (GTGTCGGGGC..GCCCTGACCC) |
Location of nic site | 56..57 |
Conserved sequence flanking the nic site |
CTGG|CTTA |
Note | The R13 amino residue of auxiliary protein MbeC_ColE1 is essential to the DNA-binding activity [PMID:19114496]. |
oriT sequence
Download Length: 60 nt
GGGTGTCGGGGCGCAGCCCTGACCCAGTCACGTAGCGATAGCGGAGTGTATACTGGCTTA
Visualization of oriT structure (The oriT was characterized experimentally)
oriT secondary structure
Predicted by RNAfold.
Download structure fileReference
[1] Rogge ML et al. (2013) Comparison of Vietnamese and US isolates of Edwardsiella ictaluri. Dis Aquat Organ. 106(1):17-29. [PMID:24062549]
[2] Varsaki A et al. (2009) Analysis of ColE1 MbeC unveils an extended ribbon-helix-helix family of nicking accessory proteins. J Bacteriol. 191(5):1446-55. [PMID:19114496]
[3] Francia MV et al. (2004) A classification scheme for mobilization regions of bacterial plasmids. FEMS Microbiol Rev. 28(1):79-100. [PMID:14975531]
Relaxosome
This oriT is a component of a relaxosome.
Relaxosome name | RelaxosomeColE1 |
oriT | oriT_ColE1 |
Relaxase | MbeA_ColE1 (MOBP) |
Auxiliary protein | MbeB_ColE1 , MbeC_ColE1 |
Reference
[1] Rogge ML et al. (2013) Comparison of Vietnamese and US isolates of Edwardsiella ictaluri. Dis Aquat Organ. 106(1):17-29. [PMID:24062549]
[2] Varsaki A et al. (2009) Analysis of ColE1 MbeC unveils an extended ribbon-helix-helix family of nicking accessory proteins. J Bacteriol. 191(5):1446-55. [PMID:19114496]
[3] Francia MV et al. (2004) A classification scheme for mobilization regions of bacterial plasmids. FEMS Microbiol Rev. 28(1):79-100. [PMID:14975531]
Relaxase
ID | 174 | GenBank | CAA33883 |
Name | MbeA_ColE1 | UniProt ID | P13658 |
Length | 517 a.a. | PDB ID | |
Note | relaxase |
Relaxase protein sequence
Download Length: 517 a.a. Molecular weight: 57808.29 Da Isoelectric Point: 6.0811
MIVKFHARGKGGGSGPVDYLLGRERNREGATVLQGNPEEVRELIDATPFAKKYTSGVLSFAEKELPPGGR
EKVMASFERVLMPGLEKNQYSILWVEHQDKGRLELNFVIPNMELQTGKRLQPYYDRADRPRIDAWQTLVN
HHYGLHDPNAPENRRTLTLPDNLPETKQALAEGVTRGIDALYHAGEIKGRQDVIQALTEAGLEVVRVTRT
SISIADPNGGKNIRLKGAFYEQSFADGRGVREKAERESRIYRENAEQRVQEARRICKRGCDIKRDENQRR
YSPVHSLDRGIAGKTPGRGERGDDAAQEGRVKAGREYGHDVTGDSLSPVYREWRDALVSWREDTGEPGRN
QEAGRDIAETEREDMGRGVCAGREQEIPCPSVREISGGDSLSGERVGTSEGVTQSDRAGNTFAERLRAAA
TGLYAAAERMGERLRGIAEDVFAYATGQRDAERAGHAVESAGAALERADRTLEPVIQRELEIREERLIQE
REHVLSLERERQPEIQERTLDGPSLGW
Protein domains
Predicted by InterproScan.
Protein structure
Source | ID | Structure |
---|---|---|
AlphaFold DB | P13658 |
Reference
[1] Varsaki A et al. (2009) Analysis of ColE1 MbeC unveils an extended ribbon-helix-helix family of nicking accessory proteins. J Bacteriol. 191(5):1446-55. [PMID:19114496]
[2] Francia MV et al. (2004) A classification scheme for mobilization regions of bacterial plasmids. FEMS Microbiol Rev. 28(1):79-100. [PMID:14975531]
Auxiliary protein
ID | 250 | GenBank | CAA33884 |
Name | MbeB_ColE1 | UniProt ID | P13659 |
Length | 172 a.a. | PDB ID | _ |
Note | _ |
Auxiliary protein sequence
Download Length: 172 a.a. Molecular weight: 19547.43 Da Isoelectric Point: 7.3220
MSNLLQTGAEFEKKLKERAESTEKMLNNEFRRLGESVSEAVTSNETKIRDAIALFTASTEESLEKHREGV
KEAMMQHRRDVLKLAGNTGMMLLGIVFLLFTASGGTLWYLGGRIQANLEEIRKQEETLQKLNAKTWGVEF
VQDGNRKFLVLPYGKSAEVIPFQGKEWVHLKE
Protein domains
Predicted by InterproScan.
Protein structure
Source | ID | Structure |
---|---|---|
AlphaFold DB | P13659 |
Reference
[1] Varsaki A et al. (2009) Analysis of ColE1 MbeC unveils an extended ribbon-helix-helix family of nicking accessory proteins. J Bacteriol. 191(5):1446-55. [PMID:19114496]
[2] Francia MV et al. (2004) A classification scheme for mobilization regions of bacterial plasmids. FEMS Microbiol Rev. 28(1):79-100. [PMID:14975531]
ID | 251 | GenBank | CAA33882 |
Name | MbeC_ColE1 | UniProt ID | P13657 |
Length | 107 a.a. | PDB ID | _ |
Note | The R13 amino residue of auxiliary protein MbeC_ColE1 is essential to the DNA-binding activity [PMID:19114496]. |
Auxiliary protein sequence
Download Length: 107 a.a. Molecular weight: 11855.71 Da Isoelectric Point: 10.8973
MLTIRVTDDEHARLLERCEGKQLAVWMRRVCLGEPVARSGKLPTLAPPLLRQLAAIGNNLNQTARKVNSG
QWSSGDRVQVVAALMAIGDELRRLRLAVREQGARDDS
Protein domains
Predicted by InterproScan.
Protein structure
Source | ID | Structure |
---|---|---|
AlphaFold DB | P13657 |
Reference
[1] Varsaki A et al. (2009) Analysis of ColE1 MbeC unveils an extended ribbon-helix-helix family of nicking accessory proteins. J Bacteriol. 191(5):1446-55. [PMID:19114496]
[2] Francia MV et al. (2004) A classification scheme for mobilization regions of bacterial plasmids. FEMS Microbiol Rev. 28(1):79-100. [PMID:14975531]
Host bacterium
ID | 174 | GenBank | NC_001371 |
Plasmid name | ColE1 | Incompatibility group | ColRNAI |
Plasmid size | 6646 bp | Coordinate of oriT [Strand] | 1462..1521 [-] |
Host baterium | Escherichia coli |
Cargo genes
Drug resistance gene | _ |
Virulence gene | - |
Metal resistance gene | - |
Degradation gene | - |
Symbiosis gene | - |
Anti-CRISPR | - |