Detailed information of auxiliary protein

Auxiliary protein

• ID: 251
• GenBank: CAA33882
• Name: MbeC_ColE1
• UniProt ID: P13657
• Length: 107 a.a.
• PDB ID: _
• Note: The R13 amino residue of auxiliary protein MbeC_ColE1 is essential to the DNA-binding activity [PMID:19114496].

Protein sequence

• Length: 107 a.a.
• Molecular weight: 11855.71 Da
• Isoelectric Point: 10.8973

>CAA33882.1 unnamed protein product (plasmid) [Plasmid ColE1]
MLTIRVTDDEHARLLERCEGKQLAVWMRRVCLGEPVARSGKLPTLAPPLLRQLAAIGNNLNQTARKVNSG
QWSSGDRVQVVAALMAIGDELRRLRLAVREQGARDDS

Protein domains

Predicted by InterproScan

• Bacterial mobilisation protein (MobC) (MobC) (50-94)

Protein structure

• AlphaFold DB: P13657

Reference

[1] Varsaki A et al. (2009) Analysis of ColE1 MbeC unveils an extended ribbon-helix-helix family of nicking accessory proteins. J Bacteriol. 191(5):1446-55. [PMID:19114496]
[2] Francia MV et al. (2004) A classification scheme for mobilization regions of bacterial plasmids. FEMS Microbiol Rev. 28(1):79-100. [PMID:14975531]