Detailed information of auxiliary protein

Auxiliary protein

• ID: 250
• GenBank: CAA33884
• Name: MbeC_ColE1
• UniProt ID: P13659
• Length: 172 a.a.
• PDB ID: _
• Note: _

Protein sequence

• Length: 172 a.a.
• Molecular weight: 19547.43 Da
• Isoelectric Point: 7.3220

>CAA33884.1 unnamed protein product (plasmid) [Plasmid ColE1]
MSNLLQTGAEFEKKLKERAESTEKMLNNEFRRLGESVSEAVTSNETKIRDAIALFTASTEESLEKHREGV
KEAMMQHRRDVLKLAGNTGMMLLGIVFLLFTASGGTLWYLGGRIQANLEEIRKQEETLQKLNAKTWGVEF
VQDGNRKFLVLPYGKSAEVIPFQGKEWVHLKE

Protein domains

Predicted by InterproScan

• MbeB-like, N-term conserved region (MbeB_N) (1-52)

Protein structure

• AlphaFold DB: P13659

Reference

[1] Varsaki A et al. (2009) Analysis of ColE1 MbeC unveils an extended ribbon-helix-helix family of nicking accessory proteins. J Bacteriol. 191(5):1446-55. [PMID:19114496]
[2] Francia MV et al. (2004) A classification scheme for mobilization regions of bacterial plasmids. FEMS Microbiol Rev. 28(1):79-100. [PMID:14975531]