Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   100003
Name   oriT_RSF1010 experimental
Organism   Escherichia coli
Sequence Completeness      core
NCBI accession of oriT (coordinates [strand])   M28829 (3132..3169 [-], 38 nt)
oriT length   38 nt
IRs (inverted repeats)      1..10, 14..23  (CCAGTTTCTC..GAGAAACCGG)
Location of nic site      31..32
Conserved sequence flanking the
  nic site    		  TAAGTGCG|CCCT
Note   _

  oriT sequence  


Download         Length: 38 nt

>oriT_RSF1010
CCAGTTTCTCGAAGAGAAACCGGTAAGTGCGCCCTCCC

Visualization of oriT structure (The oriT was characterized experimentally)

  oriT secondary structure

Predicted by RNAfold.

Download structure file

  Reference


[1] Meyer R (2009) Replication and conjugative mobilization of broad host-range IncQ plasmids. Plasmid. 62(2):57-70. [PMID:19465049]
[2] Scherzinger E et al. (1993) Purification of the large mobilization protein of plasmid RSF1010 and characterization of its site-specific DNA-cleaving/DNA-joining activity. Eur J Biochem. 217(3):929-38. [PMID:8223650]
[3] Cook DM et al. (1992) The oriT region of the Agrobacterium tumefaciens Ti plasmid pTiC58 shares DNA sequence identity with the transfer origins of RSF1010 and RK2/RP4 and with T-region borders. J Bacteriol. 174(19):6238-46. [PMID:1400174]


Relaxosome

This oriT is a component of a relaxosome.

Relaxosome name   RelaxosomeRSF1010 in_silico
oriT   oriT_RSF1010 experimental
Relaxase   MobA_RSF1010 experimental (MOBQ)
Auxiliary protein   MobB_RSF1010 experimental, MobC_RSF1010 experimental

  Reference


[1] Meyer R (2009) Replication and conjugative mobilization of broad host-range IncQ plasmids. Plasmid. 62(2):57-70. [PMID:19465049]
[2] Scherzinger E et al. (1993) Purification of the large mobilization protein of plasmid RSF1010 and characterization of its site-specific DNA-cleaving/DNA-joining activity. Eur J Biochem. 217(3):929-38. [PMID:8223650]
[3] Cook DM et al. (1992) The oriT region of the Agrobacterium tumefaciens Ti plasmid pTiC58 shares DNA sequence identity with the transfer origins of RSF1010 and RK2/RP4 and with T-region borders. J Bacteriol. 174(19):6238-46. [PMID:1400174]


Relaxase

ID   3 GenBank   AAA26445
Name   MobA_RSF1010 experimental UniProt ID   P07112
Length   709 a.a. PDB ID   
Note   relaxase

  Relaxase protein sequence


Download         Length: 709 a.a.        Molecular weight: 77951.91 Da        Isoelectric Point: 7.2077

>AAA26445.1 mobilization protein A (plasmid) [Escherichia coli]
MAIYHLTAKTGSRSGGQSARAKADYIQREGKYARDMDEVLHAESGHMPEFVERPADYWDAADLYERANGR
LFKEVEFALPVELTLDQQKALASEFAQHLTGAERLPYTLAIHAGGGENPHCHLMISERINDGIERPAAQW
FKRYNGKTPEKGGAQKTEALKPKAWLEQTREAWADHANRALERAGHDARIDHRTLEAQGIERLPGVHLGP
NVVEMEGRGIRTDRADVALNIDTANAQIIDLQEYREAIDHERNRQSEEIQRHQRVSGADRTAGPEHGDTG
RRSPAGHEPDPAGQRGAGGGVAESPAPDRGGMGGAGQRVAGGSRRGEQRRAERPERVAGVALEAMANRDA
GFHDAYGGAADRIVALARPDATDNRGRLDLAALGGPMKNDRTLQAIGRQLKAMGCERFDIGVRDATTGQM
MNREWSAAEVLQNTPWLKRMNAQGNDVYIRPAEQERHGLVLVDDLSEFDLDDMKAEGREPALVVETSPKN
YQAWVKVADAAGGELRGQIARTLASEYDADPASADSRHYGRLAGFTNRKDKHTTRAGYQPWVLLRESKGK
TATAGPALVQQAGQQIEQAQRQQEKARRLASLELPERQLSRHRRTALDEYRSEMAGLVKRFGDDLSKCDF
IAAQKLASRGRSAEEIGKAMAEASPALAERKPGHEADYIERTVSKVMGLPSVQLARAELARAPAPRQRGM
DRGGPDFSM

  Protein domains


Predicted by InterproScan.

RepB DNA-primase from phage plasmid (RepB_primase)

(410-591)

MobA/MobL family (MobA_MobL)

(37-217)


  Protein structure


Source ID Structure
PDB 2NS6
AlphaFold DB P07112

  Reference


[1] Meyer R (2009) Replication and conjugative mobilization of broad host-range IncQ plasmids. Plasmid. 62(2):57-70. [PMID:19465049]
[2] Scherzinger E et al. (1993) Purification of the large mobilization protein of plasmid RSF1010 and characterization of its site-specific DNA-cleaving/DNA-joining activity. Eur J Biochem. 217(3):929-38. [PMID:8223650]


Auxiliary protein

ID   7 GenBank   AAA26446
Name   MobB_RSF1010 experimental UniProt ID   P07113
Length   137 a.a. PDB ID   _
Note   _

  Auxiliary protein sequence


Download         Length: 137 a.a.        Molecular weight: 15112.46 Da        Isoelectric Point: 5.8900

>AAA26446.1 mobilization protein B (plasmid) [Escherichia coli]
MNAIDRVKKSRGINELAEQIEPLAQSMATLADEARQVMSQTQQASEAQAAEWLKAQRQTGAAWVELAKEL
REVAAEVSSAAQSARSASRGWHWKLWLTVMLASMMPTVVLLIASLLLLDLTPLTTEDGSIWLRLVAR

  Protein domains


Predicted by InterproScan.

Mobilization protein B (Mobilization_B)

(1-132)


  Protein structure


Source ID Structure
AlphaFold DB P07113

  Reference


[1] Scherzinger E et al. (1993) Purification of the large mobilization protein of plasmid RSF1010 and characterization of its site-specific DNA-cleaving/DNA-joining activity. Eur J Biochem. 217(3):929-38. [PMID:8223650]

ID   8 GenBank   AAA26444
Name   MobC_RSF1010 experimental UniProt ID   P07114
Length   94 a.a. PDB ID   _
Note   _

  Auxiliary protein sequence


Download         Length: 94 a.a.        Molecular weight: 10883.41 Da        Isoelectric Point: 10.4580

>AAA26444.1 mobilization protein C (plasmid) [Escherichia coli]
MVKGSNKAADRLAKLEEQRARINAEIQRVRAREQQQERKNETRRKVLVGAMILAKVNSSEWPEDRLMAAM
DAYLERDHDRALFGLPPRQKDEPG

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB P07114

  Reference


[1] Scherzinger E et al. (1993) Purification of the large mobilization protein of plasmid RSF1010 and characterization of its site-specific DNA-cleaving/DNA-joining activity. Eur J Biochem. 217(3):929-38. [PMID:8223650]


Host bacterium

ID   3 GenBank   M28829
Plasmid name   RSF1010 Incompatibility group   IncQ1
Plasmid size   8684 bp Coordinate of oriT [Strand]   3132..3169 [-]
Host baterium   Escherichia coli

Cargo genes

Drug resistance gene   resistance to sulfonamide
type II sulfonamide resistance dihydropteroate synthase (sulII) gene
Virulence gene   _
Metal resistance gene   _
Degradation gene   _
Symbiosis gene   -
Anti-CRISPR   -