Detailed information of auxiliary protein

Auxiliary protein

• ID: 7
• GenBank: AAA26446
• Name: MobC_RSF1010
• UniProt ID: P07113
• Length: 137 a.a.
• PDB ID: _
• Note: _

Protein sequence

• Length: 137 a.a.
• Molecular weight: 15112.46 Da
• Isoelectric Point: 5.8900

>AAA26446.1 mobilization protein B (plasmid) [Escherichia coli]
MNAIDRVKKSRGINELAEQIEPLAQSMATLADEARQVMSQTQQASEAQAAEWLKAQRQTGAAWVELAKEL
REVAAEVSSAAQSARSASRGWHWKLWLTVMLASMMPTVVLLIASLLLLDLTPLTTEDGSIWLRLVAR

Protein domains

Predicted by InterproScan

• Mobilization protein B (Mobilization_B) (1-132)

Protein structure

• AlphaFold DB: P07113

Reference

[1] Scherzinger E et al. (1993) Purification of the large mobilization protein of plasmid RSF1010 and characterization of its site-specific DNA-cleaving/DNA-joining activity. Eur J Biochem. 217(3):929-38. [PMID:8223650]