Detailed information of auxiliary protein

Auxiliary protein


ID   8 GenBank   AAA26444
Name   MobC_RSF1010 experimental UniProt ID   P07114
Length   94 a.a. PDB ID   _
Note   _

  Protein sequence


Download         Length: 94 a.a.        Molecular weight: 10883.41 Da        Isoelectric Point: 10.4580

>AAA26444.1 mobilization protein C (plasmid) [Escherichia coli]
MVKGSNKAADRLAKLEEQRARINAEIQRVRAREQQQERKNETRRKVLVGAMILAKVNSSEWPEDRLMAAM
DAYLERDHDRALFGLPPRQKDEPG

  Protein domains



No domain identified.


  Protein structure


Source ID Structure
AlphaFold DB P07114

  Reference


[1] Scherzinger E et al. (1993) Purification of the large mobilization protein of plasmid RSF1010 and characterization of its site-specific DNA-cleaving/DNA-joining activity. Eur J Biochem. 217(3):929-38. [PMID:8223650]