Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 41396..41660 | Replicon | plasmid p87 |
Accession | NZ_CP023385 | ||
Organism | Escherichia coli strain 1223 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Y6M3 |
Locus tag | CNQ49_RS25610 | Protein ID | WP_001331364.1 |
Coordinates | 41508..41660 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 41396..41458 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CNQ49_RS25595 | 36635..38926 | - | 2292 | WP_001289276.1 | hypothetical protein | - |
CNQ49_RS25600 | 38919..39989 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
CNQ49_RS25605 | 40008..41216 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
- | 41396..41458 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 41396..41458 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 41396..41458 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 41396..41458 | - | 63 | NuclAT_0 | - | Antitoxin |
CNQ49_RS25610 | 41508..41660 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
CNQ49_RS25615 | 41732..41983 | - | 252 | WP_001291964.1 | hypothetical protein | - |
CNQ49_RS26505 | 42642..42818 | - | 177 | WP_001054897.1 | hypothetical protein | - |
CNQ49_RS25620 | 43210..43419 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
CNQ49_RS25625 | 43491..44141 | - | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
CNQ49_RS25630 | 44215..46383 | - | 2169 | WP_000698357.1 | DotA/TraY family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Conjugative plasmid | blaCMY-2 | - | 1..87770 | 87770 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T81101 WP_001331364.1 NZ_CP023385:41508-41660 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T81101 NZ_CP023385:41508-41660 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT81101 NZ_CP023385:c41458-41396 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|