Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 6487..6751 | Replicon | plasmid p92 |
| Accession | NZ_CP023365 | ||
| Organism | Escherichia coli strain 144 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | E6BRV3 |
| Locus tag | CNQ53_RS26800 | Protein ID | WP_001303307.1 |
| Coordinates | 6487..6639 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 6689..6751 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CNQ53_RS26775 | 1765..3927 | + | 2163 | WP_000698351.1 | DotA/TraY family protein | - |
| CNQ53_RS26780 | 3992..4654 | + | 663 | WP_000653334.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| CNQ53_RS26785 | 4726..4935 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| CNQ53_RS27875 | 5327..5503 | + | 177 | WP_001054904.1 | hypothetical protein | - |
| CNQ53_RS26790 | 5568..5864 | - | 297 | WP_001275298.1 | hypothetical protein | - |
| CNQ53_RS26795 | 6164..6415 | + | 252 | WP_001291964.1 | hypothetical protein | - |
| CNQ53_RS26800 | 6487..6639 | - | 153 | WP_001303307.1 | Hok/Gef family protein | Toxin |
| - | 6689..6751 | + | 63 | NuclAT_0 | - | Antitoxin |
| - | 6689..6751 | + | 63 | NuclAT_0 | - | Antitoxin |
| - | 6689..6751 | + | 63 | NuclAT_0 | - | Antitoxin |
| - | 6689..6751 | + | 63 | NuclAT_0 | - | Antitoxin |
| CNQ53_RS26805 | 6931..8139 | + | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| CNQ53_RS26810 | 8158..9228 | + | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
| CNQ53_RS26815 | 9221..11512 | + | 2292 | WP_001289276.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Conjugative plasmid | blaCMY-2 | - | 1..92421 | 92421 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5817.21 Da Isoelectric Point: 8.7948
>T80951 WP_001303307.1 NZ_CP023365:c6639-6487 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T80951 NZ_CP023365:c6639-6487 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT80951 NZ_CP023365:6689-6751 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|