Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
| Location | 25285..25499 | Replicon | plasmid pA |
| Accession | NZ_CP019513 | ||
| Organism | Enterococcus faecalis strain CLB21560 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | BZG32_RS16345 | Protein ID | WP_107164701.1 |
| Coordinates | 25389..25499 (-) | Length | 37 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 25285..25349 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BZG32_RS16315 | 21333..22343 | - | 1011 | WP_002365949.1 | replication initiator protein A | - |
| BZG32_RS16325 | 22815..23660 | + | 846 | WP_000239313.1 | AAA family ATPase | - |
| BZG32_RS16330 | 23653..24024 | + | 372 | WP_000049959.1 | replication-associated protein RepC | - |
| BZG32_RS16335 | 24128..24418 | - | 291 | WP_002365947.1 | hypothetical protein | - |
| BZG32_RS16340 | 24589..25050 | - | 462 | WP_002365946.1 | hypothetical protein | - |
| - | 25247..25349 | + | 103 | NuclAT_0 | - | - |
| - | 25247..25349 | + | 103 | NuclAT_0 | - | - |
| - | 25247..25349 | + | 103 | NuclAT_0 | - | - |
| - | 25247..25349 | + | 103 | NuclAT_0 | - | - |
| - | 25285..25349 | + | 65 | - | - | Antitoxin |
| BZG32_RS16345 | 25389..25499 | - | 111 | WP_107164701.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| BZG32_RS16355 | 25750..26100 | - | 351 | WP_002365943.1 | hypothetical protein | - |
| BZG32_RS16360 | 26097..27425 | - | 1329 | WP_002387639.1 | Y-family DNA polymerase | - |
| BZG32_RS16365 | 27852..28154 | - | 303 | WP_002365939.1 | hypothetical protein | - |
| BZG32_RS16370 | 28166..28375 | - | 210 | WP_002387638.1 | hypothetical protein | - |
| BZG32_RS16375 | 28436..28660 | - | 225 | WP_010708492.1 | hypothetical protein | - |
| BZG32_RS16380 | 28654..28941 | - | 288 | WP_010708491.1 | hypothetical protein | - |
| BZG32_RS16385 | 28958..29578 | - | 621 | WP_021732893.1 | recombinase family protein | - |
| BZG32_RS16390 | 29755..30018 | + | 264 | WP_000245205.1 | PbsX family transcriptional regulator | - |
| BZG32_RS16395 | 30012..30374 | + | 363 | WP_000241511.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Non-Mobilizable plasmid | aac(6')-aph(2'') / qacZ / dfrG | asa1 | 1..66602 | 66602 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4090.89 Da Isoelectric Point: 4.1672
>T72612 WP_107164701.1 NZ_CP019513:c25499-25389 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK
Download Length: 111 bp
>T72612 NZ_CP019513:c25499-25389 [Enterococcus faecalis]
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCAATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAGCCGAAAGTAA
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCAATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAGCCGAAAGTAA
Antitoxin
Download Length: 65 bp
>AT72612 NZ_CP019513:25285-25349 [Enterococcus faecalis]
AACGACATTAAATCGTACAGATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
AACGACATTAAATCGTACAGATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|