Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) fst-RNAII/-
Location 63274..63479 Replicon plasmid pTEF1
Accession NC_004669
Organism Enterococcus faecalis V583

Toxin (Protein)


Gene name fst Uniprot ID -
Locus tag EF_RS16500 Protein ID WP_002387930.1
Coordinates 63274..63375 (+) Length 34 a.a.

Antitoxin (RNA)


Gene name RNAII
Locus tag -
Coordinates 63415..63479 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EF_RS16455 (EF_A0071) 58390..58752 - 363 WP_000241511.1 type II toxin-antitoxin system PemK/MazF family toxin -
EF_RS16460 (EF_A0072) 58746..59009 - 264 WP_000245205.1 PbsX family transcriptional regulator -
EF_RS16465 (EF_A0073) 59186..59806 + 621 WP_021732893.1 recombinase family protein -
EF_RS16470 (EF_A0074) 59823..60110 + 288 WP_010708491.1 hypothetical protein -
EF_RS16475 60104..60328 + 225 WP_010708492.1 ultraviolet resistance protein UvrA repressor UvrC -
EF_RS16480 (EF_A0075) 60389..60598 + 210 WP_002387638.1 hypothetical protein -
EF_RS16895 60760..60912 + 153 WP_225850000.1 DUF6440 family protein -
EF_RS16490 (EF_A0078) 61339..62667 + 1329 WP_002387639.1 ultraviolet resistance protein UvrA -
EF_RS16495 (EF_A0079) 62664..63014 + 351 WP_002365943.1 hypothetical protein -
EF_RS16900 (EF_A0080) 62971..63183 + 213 WP_002365945.1 hypothetical protein -
EF_RS16500 63274..63375 + 102 WP_002387930.1 type I toxin-antitoxin system Fst family toxin Toxin
- 63415..63479 - 65 - - Antitoxin
EF_RS16505 (EF_A0081) 63714..64175 + 462 WP_002365946.1 hypothetical protein -
EF_RS16705 64346..64636 + 291 WP_002365947.1 hypothetical protein -
EF_RS16510 (EF_A0082) 64740..65111 - 372 WP_000049959.1 replication-associated protein RepC -
EF_RS16515 (EF_A0083) 65104..65949 - 846 WP_000239313.1 AAA family ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Non-Mobilizable plasmid erm(B) / qacZ / aac(6')-aph(2'') asa1 1..66320 66320


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 34 a.a.        Molecular weight: 3731.42 Da        Isoelectric Point: 4.1672

>T20928 WP_002387930.1 NC_004669:63274-63375 [Enterococcus faecalis V583]
VKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK

Download         Length: 102 bp

>T20928 NC_004669:63274-63375 [Enterococcus faecalis V583]
GTGAAAGATTTAATGTCGTTGGTTATCGCACCAATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGTGTTGGACGA
GGAAGACGATAGCCGAAAGTAA

Antitoxin


Download         Length: 65 bp

>AT20928 NC_004669:c63479-63415 [Enterococcus faecalis V583]
AACGACATTAAATCGTACAGATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References