Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/- |
| Location | 63274..63479 | Replicon | plasmid pTEF1 |
| Accession | NC_004669 | ||
| Organism | Enterococcus faecalis V583 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | EF_RS16500 | Protein ID | WP_002387930.1 |
| Coordinates | 63274..63375 (+) | Length | 34 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 63415..63479 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EF_RS16455 (EF_A0071) | 58390..58752 | - | 363 | WP_000241511.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| EF_RS16460 (EF_A0072) | 58746..59009 | - | 264 | WP_000245205.1 | PbsX family transcriptional regulator | - |
| EF_RS16465 (EF_A0073) | 59186..59806 | + | 621 | WP_021732893.1 | recombinase family protein | - |
| EF_RS16470 (EF_A0074) | 59823..60110 | + | 288 | WP_010708491.1 | hypothetical protein | - |
| EF_RS16475 | 60104..60328 | + | 225 | WP_010708492.1 | ultraviolet resistance protein UvrA repressor UvrC | - |
| EF_RS16480 (EF_A0075) | 60389..60598 | + | 210 | WP_002387638.1 | hypothetical protein | - |
| EF_RS16895 | 60760..60912 | + | 153 | WP_225850000.1 | DUF6440 family protein | - |
| EF_RS16490 (EF_A0078) | 61339..62667 | + | 1329 | WP_002387639.1 | ultraviolet resistance protein UvrA | - |
| EF_RS16495 (EF_A0079) | 62664..63014 | + | 351 | WP_002365943.1 | hypothetical protein | - |
| EF_RS16900 (EF_A0080) | 62971..63183 | + | 213 | WP_002365945.1 | hypothetical protein | - |
| EF_RS16500 | 63274..63375 | + | 102 | WP_002387930.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 63415..63479 | - | 65 | - | - | Antitoxin |
| EF_RS16505 (EF_A0081) | 63714..64175 | + | 462 | WP_002365946.1 | hypothetical protein | - |
| EF_RS16705 | 64346..64636 | + | 291 | WP_002365947.1 | hypothetical protein | - |
| EF_RS16510 (EF_A0082) | 64740..65111 | - | 372 | WP_000049959.1 | replication-associated protein RepC | - |
| EF_RS16515 (EF_A0083) | 65104..65949 | - | 846 | WP_000239313.1 | AAA family ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Non-Mobilizable plasmid | erm(B) / qacZ / aac(6')-aph(2'') | asa1 | 1..66320 | 66320 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 34 a.a. Molecular weight: 3731.42 Da Isoelectric Point: 4.1672
>T20928 WP_002387930.1 NC_004669:63274-63375 [Enterococcus faecalis V583]
VKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK
VKDLMSLVIAPIFVGLVLEMISRVLDEEDDSRK
Download Length: 102 bp
>T20928 NC_004669:63274-63375 [Enterococcus faecalis V583]
GTGAAAGATTTAATGTCGTTGGTTATCGCACCAATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGTGTTGGACGA
GGAAGACGATAGCCGAAAGTAA
GTGAAAGATTTAATGTCGTTGGTTATCGCACCAATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGTGTTGGACGA
GGAAGACGATAGCCGAAAGTAA
Antitoxin
Download Length: 65 bp
>AT20928 NC_004669:c63479-63415 [Enterococcus faecalis V583]
AACGACATTAAATCGTACAGATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
AACGACATTAAATCGTACAGATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|