296535

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsxAB/MqsA(antitoxin)
Location 4537..5002 Replicon plasmid P4
Accession NZ_OX030705
Organism Escherichia coli isolate 131

Toxin (Protein)


Gene name TsxA Uniprot ID U9ZUY2
Locus tag LQ128_RS26325 Protein ID WP_001230707.1
Coordinates 4537..4788 (+) Length 84 a.a.

Antitoxin (Protein)


Gene name TsxB Uniprot ID M7CCF8
Locus tag LQ128_RS26330 Protein ID WP_000801440.1
Coordinates 4775..5002 (+) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LQ128_RS26300 (AI2951V1_5058) 18..545 - 528 WP_000577043.1 DUF2726 domain-containing protein -
LQ128_RS26305 (AI2951V1_5059) 680..1084 - 405 WP_012421203.1 hypothetical protein -
LQ128_RS26310 (AI2951V1_5060) 1097..1963 - 867 WP_001353743.1 replication initiation protein -
LQ128_RS26315 (AI2951V1_5062) 3378..3893 + 516 WP_001025395.1 J domain-containing protein -
LQ128_RS26320 (AI2951V1_5063) 3998..4540 + 543 WP_001083906.1 hypothetical protein -
LQ128_RS26325 (AI2951V1_5064) 4537..4788 + 252 WP_001230707.1 hypothetical protein Toxin
LQ128_RS26330 (AI2951V1_5065) 4775..5002 + 228 WP_000801440.1 hypothetical protein Antitoxin
LQ128_RS26335 (AI2951V1_5066) 5456..5755 + 300 WP_000650309.1 hypothetical protein -
LQ128_RS26340 (AI2951V1_5067) 5846..6196 + 351 WP_000854259.1 hypothetical protein -
LQ128_RS26345 (AI2951V1_5069) 6501..6749 + 249 WP_000520549.1 type II toxin-antitoxin system HicA family toxin -
LQ128_RS26350 (AI2951V1_5070) 6746..7093 + 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin -
LQ128_RS26355 (AI2951V1_5071) 7454..7957 + 504 WP_000781813.1 relaxosome-coupling protein TaxA -
LQ128_RS26360 (AI2951V1_5072) 7961..9190 + 1230 WP_001329504.1 DNA relaxase/nickase TaxC -
LQ128_RS26365 (AI2951V1_5073) 9267..9560 + 294 WP_000134733.1 sigma factor-like helix-turn-helix DNA-binding protein -
LQ128_RS26370 (AI2951V1_5074) 9557..9772 + 216 WP_000760375.1 EexN family lipoprotein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Non-Mobilizable plasmid - - 1..31765 31765


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 84 a.a.        Molecular weight: 9751.13 Da        Isoelectric Point: 8.9187

>T296535 WP_001230707.1 NZ_OX030705:4537-4788 [Escherichia coli]
MRKNKGDVTYFLEKEGDNYRLTKRIKARTNVKIGNKTTKITLYDAVLNENELQHIDFTCAGLREDDETPVKNLIKEFMLN
ETR

Download         Length: 252 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8659.98 Da        Isoelectric Point: 8.5105

>AT296535 WP_000801440.1 NZ_OX030705:4775-5002 [Escherichia coli]
MKPDNTPENVKKLRLKAGLTQKECSHIYGVGLRTWQKKEEVNTQNSQSLSLVEFEFLLLLAGEHPEYVLCKRESK

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9ZUY2

Antitoxin

Source ID Structure
AlphaFold DB A0A5Y6U8W9

References