Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 4132814..4133439 | Replicon | chromosome |
Accession | NZ_OU015340 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain AUSMDU00027944 isolate AUSMDU00027944 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | M7SD17 |
Locus tag | KKR00_RS20865 | Protein ID | WP_000911336.1 |
Coordinates | 4133041..4133439 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | M7S3S8 |
Locus tag | KKR00_RS20860 | Protein ID | WP_000557549.1 |
Coordinates | 4132814..4133041 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KKR00_RS20830 (4127859) | 4127859..4129376 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
KKR00_RS20835 (4129452) | 4129452..4129997 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
KKR00_RS20840 (4130262) | 4130262..4131020 | + | 759 | WP_000244329.1 | amidase activator ActS | - |
KKR00_RS20850 (4131305) | 4131305..4132111 | - | 807 | WP_010989071.1 | DUF1460 domain-containing protein | - |
KKR00_RS20855 (4132386) | 4132386..4132637 | - | 252 | WP_001540858.1 | hypothetical protein | - |
KKR00_RS20860 (4132814) | 4132814..4133041 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
KKR00_RS20865 (4133041) | 4133041..4133439 | + | 399 | WP_000911336.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
KKR00_RS20870 (4134245) | 4134245..4134781 | + | 537 | WP_001038506.1 | STM3031 family outer membrane protein | - |
KKR00_RS20875 (4134828) | 4134828..4135460 | + | 633 | WP_000835265.1 | YfdX family protein | - |
KKR00_RS20880 (4136179) | 4136179..4136763 | + | 585 | WP_001244638.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 4131305..4142630 | 11325 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14938.30 Da Isoelectric Point: 7.2155
>T294648 WP_000911336.1 NZ_OU015340:4133041-4133439 [Salmonella enterica subsp. enterica serovar Typhimurium]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6IFC | |
PDB | 6IFM |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6IFM | |
AlphaFold DB | A0A3V2Y5V5 |