Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF1/- |
| Location | 2056634..2056941 | Replicon | chromosome |
| Accession | NZ_LT009690 | ||
| Organism | Staphylococcus aureus strain NZAK3 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | NZAK3_RS14955 | Protein ID | WP_011447039.1 |
| Coordinates | 2056765..2056941 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 2056634..2056773 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NZAK3_RS10375 | 2051979..2052239 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| NZAK3_RS10380 | 2052292..2052642 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| NZAK3_RS10385 | 2053325..2053774 | + | 450 | WP_000727645.1 | chemotaxis-inhibiting protein CHIPS | - |
| NZAK3_RS10390 | 2053869..2054203 | - | 335 | Protein_1963 | SH3 domain-containing protein | - |
| NZAK3_RS10395 | 2054850..2055341 | - | 492 | WP_000920042.1 | staphylokinase | - |
| NZAK3_RS10400 | 2055532..2056287 | - | 756 | WP_000861026.1 | CHAP domain-containing protein | - |
| NZAK3_RS10405 | 2056299..2056553 | - | 255 | WP_000611512.1 | phage holin | - |
| NZAK3_RS10410 | 2056605..2056712 | + | 108 | WP_031762631.1 | hypothetical protein | - |
| - | 2056634..2056773 | + | 140 | NuclAT_0 | - | Antitoxin |
| - | 2056634..2056773 | + | 140 | NuclAT_0 | - | Antitoxin |
| - | 2056634..2056773 | + | 140 | NuclAT_0 | - | Antitoxin |
| - | 2056634..2056773 | + | 140 | NuclAT_0 | - | Antitoxin |
| NZAK3_RS14955 | 2056765..2056941 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
| NZAK3_RS10415 | 2057144..2057917 | - | 774 | WP_025174055.1 | staphylococcal enterotoxin type P | - |
| NZAK3_RS10420 | 2058338..2058712 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| NZAK3_RS10425 | 2058768..2059055 | - | 288 | WP_001262621.1 | hypothetical protein | - |
| NZAK3_RS10430 | 2059101..2059253 | - | 153 | WP_001000058.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | scn / chp / sak / see / hlb / groEL | 2052292..2104420 | 52128 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T293103 WP_011447039.1 NZ_LT009690:c2056941-2056765 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT293103 NZ_LT009690:2056634-2056773 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|