Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 49682..49946 Replicon plasmid 2
Accession NZ_LR898869
Organism Escherichia coli isolate MSB1_1D-sc-2280324

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag JMX26_RS22290 Protein ID WP_001331364.1
Coordinates 49794..49946 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 49682..49744 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JMX26_RS22275 44921..47212 - 2292 WP_001289276.1 hypothetical protein -
JMX26_RS22280 47205..48275 - 1071 WP_000151583.1 IncI1-type conjugal transfer protein TrbB -
JMX26_RS22285 48294..49502 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- 49682..49744 - 63 NuclAT_0 - Antitoxin
- 49682..49744 - 63 NuclAT_0 - Antitoxin
- 49682..49744 - 63 NuclAT_0 - Antitoxin
- 49682..49744 - 63 NuclAT_0 - Antitoxin
JMX26_RS22290 49794..49946 + 153 WP_001331364.1 Hok/Gef family protein Toxin
JMX26_RS22295 50018..50269 - 252 WP_001291964.1 hypothetical protein -
JMX26_RS22300 50928..51104 - 177 WP_001054897.1 hypothetical protein -
JMX26_RS22305 51496..51705 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
JMX26_RS22310 51777..52427 - 651 WP_001178506.1 plasmid IncI1-type surface exclusion protein ExcA -
JMX26_RS22315 52501..54669 - 2169 WP_000698357.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Conjugative plasmid blaCMY-2 - 1..96021 96021


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T292049 WP_001331364.1 NZ_LR898869:49794-49946 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT292049 NZ_LR898869:c49744-49682 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References