Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 49682..49946 | Replicon | plasmid 2 |
| Accession | NZ_LR898869 | ||
| Organism | Escherichia coli isolate MSB1_1D-sc-2280324 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Y6M3 |
| Locus tag | JMX26_RS22290 | Protein ID | WP_001331364.1 |
| Coordinates | 49794..49946 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 49682..49744 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMX26_RS22275 | 44921..47212 | - | 2292 | WP_001289276.1 | hypothetical protein | - |
| JMX26_RS22280 | 47205..48275 | - | 1071 | WP_000151583.1 | IncI1-type conjugal transfer protein TrbB | - |
| JMX26_RS22285 | 48294..49502 | - | 1209 | WP_000121273.1 | IncI1-type conjugal transfer protein TrbA | - |
| - | 49682..49744 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 49682..49744 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 49682..49744 | - | 63 | NuclAT_0 | - | Antitoxin |
| - | 49682..49744 | - | 63 | NuclAT_0 | - | Antitoxin |
| JMX26_RS22290 | 49794..49946 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
| JMX26_RS22295 | 50018..50269 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| JMX26_RS22300 | 50928..51104 | - | 177 | WP_001054897.1 | hypothetical protein | - |
| JMX26_RS22305 | 51496..51705 | + | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| JMX26_RS22310 | 51777..52427 | - | 651 | WP_001178506.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| JMX26_RS22315 | 52501..54669 | - | 2169 | WP_000698357.1 | DotA/TraY family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Conjugative plasmid | blaCMY-2 | - | 1..96021 | 96021 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T292049 WP_001331364.1 NZ_LR898869:49794-49946 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT292049 NZ_LR898869:c49744-49682 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|