Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | CD-RCd/- |
| Location | 1607333..1607553 | Replicon | chromosome |
| Accession | NZ_LR698984 | ||
| Organism | Clostridioides difficile isolate MGYG-HGUT-02369 | ||
Toxin (Protein)
| Gene name | CD0956.2 | Uniprot ID | Q183Z5 |
| Locus tag | FX037_RS07655 | Protein ID | WP_003429855.1 |
| Coordinates | 1607333..1607494 (+) | Length | 54 a.a. |
Antitoxin (RNA)
| Gene name | RCd10 | ||
| Locus tag | - | ||
| Coordinates | 1607414..1607553 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FX037_RS07620 | 1603190..1603627 | + | 438 | WP_009888839.1 | hypothetical protein | - |
| FX037_RS07625 | 1603620..1603796 | + | 177 | WP_009888840.1 | hypothetical protein | - |
| FX037_RS07630 | 1603797..1605107 | + | 1311 | WP_009893136.1 | phage tail sheath family protein | - |
| FX037_RS07635 | 1605124..1605594 | + | 471 | WP_009888842.1 | phage tail tube protein | - |
| FX037_RS07640 | 1605653..1606480 | + | 828 | WP_009888843.1 | hypothetical protein | - |
| FX037_RS07645 | 1606552..1606992 | + | 441 | WP_003429853.1 | phage portal protein | - |
| FX037_RS07655 | 1607333..1607494 | + | 162 | WP_003429855.1 | hypothetical protein | Toxin |
| - | 1607414..1607553 | - | 140 | NuclAT_1 | - | Antitoxin |
| - | 1607414..1607553 | - | 140 | NuclAT_2 | - | Antitoxin |
| - | 1607898..1607946 | - | 49 | NuclAT_4 | - | - |
| - | 1607898..1607946 | - | 49 | NuclAT_5 | - | - |
| FX037_RS07660 | 1608831..1609019 | + | 189 | WP_003429858.1 | hypothetical protein | - |
| FX037_RS07665 | 1609138..1610004 | + | 867 | WP_009888845.1 | hypothetical protein | - |
| FX037_RS07675 | 1610869..1611396 | + | 528 | WP_009888847.1 | DUF4352 domain-containing protein | - |
| FX037_RS07680 | 1611534..1612301 | + | 768 | WP_009888848.1 | DUF4428 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 1576962..1639981 | 63019 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 54 a.a. Molecular weight: 6120.42 Da Isoelectric Point: 10.8938
>T288705 WP_003429855.1 NZ_LR698984:1607333-1607494 [Clostridioides difficile]
MNNFLLNVIAGVIASLIFCLICKVFLKVKSHSTRGKSKSGWEFDFKIKFHKFK
MNNFLLNVIAGVIASLIFCLICKVFLKVKSHSTRGKSKSGWEFDFKIKFHKFK
Download Length: 162 bp
Antitoxin
Download Length: 140 bp
>AT288705 NZ_LR698984:c1607553-1607414 [Clostridioides difficile]
AAGAAGAACTACAATCTATTTGACAGTAGAGTGAAGTTCATAATTTAAACAATTAGTAATTATTTAAATTTGTGGAACTT
GATTTTAAAATCAAATTCCCAGCCACTTTTACTCTTGCCACGAGTTGAGTGGCTTTTTAC
AAGAAGAACTACAATCTATTTGACAGTAGAGTGAAGTTCATAATTTAAACAATTAGTAATTATTTAAATTTGTGGAACTT
GATTTTAAAATCAAATTCCCAGCCACTTTTACTCTTGCCACGAGTTGAGTGGCTTTTTAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|