285372

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/Tad-HTH_37
Location 1120172..1120799 Replicon chromosome
Accession NZ_LC127084
Organism Edwardsiella tarda strain ET-1

Toxin (Protein)


Gene name higB Uniprot ID A0A411H7J1
Locus tag SAMD00131843_RS05240 Protein ID WP_015871332.1
Coordinates 1120470..1120799 (-) Length 110 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag SAMD00131843_RS05235 Protein ID WP_005286394.1
Coordinates 1120172..1120480 (-) Length 103 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SAMD00131843_RS05180 1115207..1115899 - 693 WP_041692511.1 helix-turn-helix transcriptional regulator -
SAMD00131843_RS05185 1116004..1116219 + 216 WP_012848463.1 helix-turn-helix domain-containing protein -
SAMD00131843_RS05190 1116317..1116673 + 357 WP_012848464.1 hypothetical protein -
SAMD00131843_RS05195 1116670..1116903 + 234 WP_005286423.1 hypothetical protein -
SAMD00131843_RS05200 1116935..1117186 + 252 WP_012848465.1 hypothetical protein -
SAMD00131843_RS05210 1117389..1118105 + 717 Protein_993 helix-turn-helix domain-containing protein -
SAMD00131843_RS17480 1118103..1118387 + 285 Protein_994 DUF1367 family protein -
SAMD00131843_RS05215 1118390..1118692 + 303 WP_012848467.1 DUF1364 domain-containing protein -
SAMD00131843_RS05220 1118981..1119226 + 246 WP_012848468.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
SAMD00131843_RS05225 1119114..1119482 + 369 WP_196796969.1 Txe/YoeB family addiction module toxin -
SAMD00131843_RS05230 1119565..1120077 - 513 WP_012848469.1 DUF2442 domain-containing protein -
SAMD00131843_RS05235 1120172..1120480 - 309 WP_005286394.1 helix-turn-helix transcriptional regulator Antitoxin
SAMD00131843_RS05240 1120470..1120799 - 330 WP_015871332.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
SAMD00131843_RS05245 1121220..1121867 + 648 Protein_1001 hypothetical protein -
SAMD00131843_RS05250 1122039..1122377 + 339 WP_012848472.1 phage holin, lambda family -
SAMD00131843_RS05255 1122380..1122931 + 552 WP_012848473.1 glycoside hydrolase family 108 protein -
SAMD00131843_RS05260 1123067..1123903 + 837 WP_080514635.1 antA/AntB antirepressor family protein -
SAMD00131843_RS05265 1124006..1124551 + 546 WP_041692512.1 DUF2514 family protein -
SAMD00131843_RS05270 1124908..1125684 + 777 WP_012848476.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 1093393..1137166 43773


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(16-103)

Antitoxin

Cro/C1-type helix-turn-helix domain

(44-97)


Sequences

Toxin        


Download         Length: 110 a.a.        Molecular weight: 12771.78 Da        Isoelectric Point: 9.6247

>T285372 WP_015871332.1 NZ_LC127084:c1120799-1120470 [Edwardsiella tarda]
MNYTIEYYSEEVRLEVDQLPMGMRVRYQHLVERMEIYGSNLGEPHTSPFGDGLFELRIKGSDGIARVFYCTLTGKRIVML
HSFIKKTQKTPSAERKKAETRMKEVKHGW

Download         Length: 330 bp

Antitoxin


Download         Length: 103 a.a.        Molecular weight: 11233.90 Da        Isoelectric Point: 8.5371

>AT285372 WP_005286394.1 NZ_LC127084:c1120480-1120172 [Edwardsiella tarda]
MAGKRTPPTMTHDEMAAKWMEDPAFKAEYDAIEEEYALLDEMLAARKNAGLTQAQVAERMGTKPTAITRMESNLASGQSG
PSFATLKKFAHATGKKLQIRFV

Download         Length: 309 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A411H7J1

Antitoxin

Source ID Structure

References