Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 882697..883322 | Replicon | chromosome |
| Accession | NZ_CP126325 | ||
| Organism | Salmonella enterica subsp. enterica strain HL21 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QN088_RS04260 | Protein ID | WP_000911337.1 |
| Coordinates | 882924..883322 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | M7S3S8 |
| Locus tag | QN088_RS04255 | Protein ID | WP_000557549.1 |
| Coordinates | 882697..882924 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QN088_RS04240 (879262) | 879262..880905 | + | 1644 | WP_284546205.1 | group II intron reverse transcriptase/maturase | - |
| QN088_RS04245 (881156) | 881156..881962 | - | 807 | WP_010989071.1 | DUF1460 domain-containing protein | - |
| QN088_RS04250 (882237) | 882237..882488 | - | 252 | WP_001673708.1 | hypothetical protein | - |
| QN088_RS04255 (882697) | 882697..882924 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| QN088_RS04260 (882924) | 882924..883322 | + | 399 | WP_000911337.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| QN088_RS04265 (884129) | 884129..884665 | + | 537 | WP_001038506.1 | STM3031 family outer membrane protein | - |
| QN088_RS04270 (884712) | 884712..885344 | + | 633 | WP_000835265.1 | YfdX family protein | - |
| QN088_RS04275 (886063) | 886063..886647 | + | 585 | WP_001244638.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 879262..892507 | 13245 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15037.43 Da Isoelectric Point: 7.7785
>T282768 WP_000911337.1 NZ_CP126325:882924-883322 [Salmonella enterica subsp. enterica]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|