Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 995605..996419 | Replicon | chromosome |
Accession | NZ_CP126138 | ||
Organism | Salmonella enterica subsp. enterica serovar Kottbus strain DSK01 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | QNM33_RS04770 | Protein ID | WP_000971655.1 |
Coordinates | 995605..996132 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | E8XL32 |
Locus tag | QNM33_RS04775 | Protein ID | WP_000855692.1 |
Coordinates | 996129..996419 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNM33_RS04750 (990905) | 990905..993472 | - | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
QNM33_RS04755 (993631) | 993631..994152 | + | 522 | WP_000858988.1 | hypothetical protein | - |
QNM33_RS04760 (994324) | 994324..994980 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
QNM33_RS04765 (995327) | 995327..995532 | + | 206 | Protein_934 | IS5/IS1182 family transposase | - |
QNM33_RS04770 (995605) | 995605..996132 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
QNM33_RS04775 (996129) | 996129..996419 | - | 291 | WP_000855692.1 | DUF1778 domain-containing protein | Antitoxin |
QNM33_RS04780 (996689) | 996689..996867 | - | 179 | Protein_937 | IS3 family transposase | - |
QNM33_RS04785 (997108) | 997108..997434 | + | 327 | WP_000393302.1 | hypothetical protein | - |
QNM33_RS04790 (997707) | 997707..998054 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
QNM33_RS04795 (998039) | 998039..998488 | - | 450 | WP_000381610.1 | membrane protein | - |
QNM33_RS04800 (998919) | 998919..999362 | - | 444 | WP_000715092.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
QNM33_RS04805 (999819) | 999819..1000469 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 995356..1005782 | 10426 | ||
flank | IS/Tn | - | - | 995356..995532 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T282657 WP_000971655.1 NZ_CP126138:c996132-995605 [Salmonella enterica subsp. enterica serovar Kottbus]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10678.57 Da Isoelectric Point: 8.5779
>AT282657 WP_000855692.1 NZ_CP126138:c996419-996129 [Salmonella enterica subsp. enterica serovar Kottbus]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A625WHV3 |