Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 849679..850304 | Replicon | chromosome |
Accession | NZ_CP126138 | ||
Organism | Salmonella enterica subsp. enterica serovar Kottbus strain DSK01 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | QNM33_RS04115 | Protein ID | WP_080247813.1 |
Coordinates | 849906..850304 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | M7S3S8 |
Locus tag | QNM33_RS04110 | Protein ID | WP_000557549.1 |
Coordinates | 849679..849906 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNM33_RS04080 (844724) | 844724..846241 | + | 1518 | WP_187790965.1 | lysine--tRNA ligase | - |
QNM33_RS04085 (846317) | 846317..846862 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
QNM33_RS04090 (847127) | 847127..847885 | + | 759 | WP_000244329.1 | amidase activator ActS | - |
QNM33_RS04100 (848170) | 848170..848976 | - | 807 | WP_010989071.1 | DUF1460 domain-containing protein | - |
QNM33_RS04105 (849251) | 849251..849502 | - | 252 | WP_001540858.1 | hypothetical protein | - |
QNM33_RS04110 (849679) | 849679..849906 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
QNM33_RS04115 (849906) | 849906..850304 | + | 399 | WP_080247813.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
QNM33_RS04120 (851110) | 851110..851646 | + | 537 | WP_001038506.1 | STM3031 family outer membrane protein | - |
QNM33_RS04125 (851693) | 851693..852325 | + | 633 | WP_000835265.1 | YfdX family protein | - |
QNM33_RS04130 (853044) | 853044..853628 | + | 585 | WP_001244638.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 848170..859495 | 11325 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14926.24 Da Isoelectric Point: 7.2155
>T282656 WP_080247813.1 NZ_CP126138:849906-850304 [Salmonella enterica subsp. enterica serovar Kottbus]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRTEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRTEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|