Detailed information of TA system TA276256

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): tacAT/DUF1778(antitoxin)
• Location: 1341297..1342111
• Replicon: chromosome
• Accession: NZ_CP121298
• Organism: Salmonella enterica subsp. enterica strain KKP 3080

Toxin (Protein)

• Gene name: TacT3
• Uniprot ID: Q57KM2
• Locus tag: P1839_RS06455
• Protein ID: WP_000971655.1
• Coordinates: 1341297..1341824 (-)
• Length: 176 a.a.

Antitoxin (Protein)

• Gene name: TacA3
• Uniprot ID: E8XL32
• Locus tag: P1839_RS06460
• Protein ID: WP_000855692.1
• Coordinates: 1341821..1342111 (-)
• Length: 97 a.a.

Genomic Context

Location: 1339323..1339844 (522 bp)
Type: Others
Protein ID: WP_000858988.1

Location: 1341019..1341224 (206 bp)
Type: Others
Protein ID: Protein_1243

Location: 1342800..1343126 (327 bp)
Type: Others
Protein ID: WP_000393302.1

Location: 1345511..1346161 (651 bp)
Type: Others
Protein ID: WP_001674874.1

Location: 1336597..1339164 (2568 bp)
Type: Others
Protein ID: WP_001005807.1

Location: 1340016..1340672 (657 bp)
Type: Others
Protein ID: WP_000420452.1

Location: 1341297..1341824 (528 bp)
Type: Toxin
Protein ID: WP_000971655.1

Location: 1341821..1342111 (291 bp)
Type: Antitoxin
Protein ID: WP_000855692.1

Location: 1342381..1342559 (179 bp)
Type: Others
Protein ID: Protein_1246

Location: 1343399..1343746 (348 bp)
Type: Others
Protein ID: WP_001669174.1

Location: 1343731..1344180 (450 bp)
Type: Others
Protein ID: WP_000381610.1

Location: 1344611..1345054 (444 bp)
Type: Others
Protein ID: WP_000715092.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
P1839_RS06435 (1336597)	1336597..1339164	-	2568	WP_001005807.1	DNA mismatch repair protein MutS	-
P1839_RS06440 (1339323)	1339323..1339844	+	522	WP_000858988.1	hypothetical protein	-
P1839_RS06445 (1340016)	1340016..1340672	-	657	WP_000420452.1	protein-serine/threonine phosphatase	-
P1839_RS06450 (1341019)	1341019..1341224	+	206	Protein_1243	IS5/IS1182 family transposase	-
P1839_RS06455 (1341297)	1341297..1341824	-	528	WP_000971655.1	GNAT family N-acetyltransferase	Toxin
P1839_RS06460 (1341821)	1341821..1342111	-	291	WP_000855692.1	DUF1778 domain-containing protein	Antitoxin
P1839_RS06465 (1342381)	1342381..1342559	-	179	Protein_1246	IS3 family transposase	-
P1839_RS06470 (1342800)	1342800..1343126	+	327	WP_000393302.1	hypothetical protein	-
P1839_RS06475 (1343399)	1343399..1343746	-	348	WP_001669174.1	DUF1493 family protein	-
P1839_RS06480 (1343731)	1343731..1344180	-	450	WP_000381610.1	membrane protein	-
P1839_RS06485 (1344611)	1344611..1345054	-	444	WP_000715092.1	SPI-1 type III secretion system invasion lipoprotein InvH	-
P1839_RS06490 (1345511)	1345511..1346161	+	651	WP_001674874.1	type III secretion system transcriptional activator InvF	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View UFRD01000002 Salmonella enterica subsp. enterica serovar Typhimurium strain NCTC12023 Genomic island TA010052 4599654..4610080 0	inside	Genomic island	-	invH / invF / invG / invE / invA / invB	1341048..1351474	10426
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_016810 Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 IS/Tn TA025955 3070795..3070971 0 View NC_016856 Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S IS/Tn TA026055 3068456..3068632 0 View UFRD01000002 Salmonella enterica subsp. enterica serovar Typhimurium strain NCTC12023 IS/Tn TA010052 4599654..4599830 0	flank	IS/Tn	-	-	1341048..1341224	176

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Antitoxin

• Vibrio phage ICP1, Orf50 (1-95)

Sequences

Toxin

Protein

• Length: 176 a.a.
• Molecular weight: 19069.91 Da
• Isoelectric Point: 9.6420

>T276256 WP_000971655.1 NZ_CP121298:c1341824-1341297 [Salmonella enterica subsp. enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL

Nucleotide

• Length: 528 bp

Antitoxin

Protein

• Length: 97 a.a.
• Molecular weight: 10678.57 Da
• Isoelectric Point: 8.5779

>AT276256 WP_000855692.1 NZ_CP121298:c1342111-1341821 [Salmonella enterica subsp. enterica]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK

Nucleotide

• Length: 291 bp

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• PDB: 6G96
• PDB: 7AK9

Antitoxin

Loading, please wait

• PDB: 7AK9
• AlphaFold DB: A0A625WHV3