Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1341297..1342111 | Replicon | chromosome |
| Accession | NZ_CP121298 | ||
| Organism | Salmonella enterica subsp. enterica strain KKP 3080 | ||
Toxin (Protein)
| Gene name | TacT3 | Uniprot ID | Q57KM2 |
| Locus tag | P1839_RS06455 | Protein ID | WP_000971655.1 |
| Coordinates | 1341297..1341824 (-) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | TacA3 | Uniprot ID | E8XL32 |
| Locus tag | P1839_RS06460 | Protein ID | WP_000855692.1 |
| Coordinates | 1341821..1342111 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P1839_RS06435 (1336597) | 1336597..1339164 | - | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
| P1839_RS06440 (1339323) | 1339323..1339844 | + | 522 | WP_000858988.1 | hypothetical protein | - |
| P1839_RS06445 (1340016) | 1340016..1340672 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
| P1839_RS06450 (1341019) | 1341019..1341224 | + | 206 | Protein_1243 | IS5/IS1182 family transposase | - |
| P1839_RS06455 (1341297) | 1341297..1341824 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
| P1839_RS06460 (1341821) | 1341821..1342111 | - | 291 | WP_000855692.1 | DUF1778 domain-containing protein | Antitoxin |
| P1839_RS06465 (1342381) | 1342381..1342559 | - | 179 | Protein_1246 | IS3 family transposase | - |
| P1839_RS06470 (1342800) | 1342800..1343126 | + | 327 | WP_000393302.1 | hypothetical protein | - |
| P1839_RS06475 (1343399) | 1343399..1343746 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
| P1839_RS06480 (1343731) | 1343731..1344180 | - | 450 | WP_000381610.1 | membrane protein | - |
| P1839_RS06485 (1344611) | 1344611..1345054 | - | 444 | WP_000715092.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
| P1839_RS06490 (1345511) | 1345511..1346161 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1341048..1351474 | 10426 | ||
| flank | IS/Tn | - | - | 1341048..1341224 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T276256 WP_000971655.1 NZ_CP121298:c1341824-1341297 [Salmonella enterica subsp. enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6G96 | |
| PDB | 7AK9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK9 | |
| AlphaFold DB | A0A625WHV3 |