Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1194879..1195504 | Replicon | chromosome |
Accession | NZ_CP121298 | ||
Organism | Salmonella enterica subsp. enterica strain KKP 3080 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | M7SD17 |
Locus tag | P1839_RS05795 | Protein ID | WP_000911336.1 |
Coordinates | 1195106..1195504 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | M7S3S8 |
Locus tag | P1839_RS05790 | Protein ID | WP_000557549.1 |
Coordinates | 1194879..1195106 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P1839_RS05760 (1189924) | 1189924..1191441 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
P1839_RS05765 (1191517) | 1191517..1192062 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
P1839_RS05770 (1192327) | 1192327..1193085 | + | 759 | WP_000244329.1 | amidase activator ActS | - |
P1839_RS05780 (1193370) | 1193370..1194176 | - | 807 | WP_185609406.1 | DUF1460 domain-containing protein | - |
P1839_RS05785 (1194451) | 1194451..1194702 | - | 252 | WP_001540858.1 | hypothetical protein | - |
P1839_RS05790 (1194879) | 1194879..1195106 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
P1839_RS05795 (1195106) | 1195106..1195504 | + | 399 | WP_000911336.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
P1839_RS05800 (1196310) | 1196310..1196846 | + | 537 | WP_278219242.1 | STM3031 family outer membrane protein | - |
P1839_RS05805 (1196893) | 1196893..1197525 | + | 633 | WP_000835265.1 | YfdX family protein | - |
P1839_RS05810 (1198244) | 1198244..1198828 | + | 585 | WP_001244638.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 1194451..1204695 | 10244 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14938.30 Da Isoelectric Point: 7.2155
>T276255 WP_000911336.1 NZ_CP121298:1195106-1195504 [Salmonella enterica subsp. enterica]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6IFC | |
PDB | 6IFM |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6IFM | |
AlphaFold DB | A0A3V2Y5V5 |