Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 997799..998613 | Replicon | chromosome |
Accession | NZ_CP117398 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain RM015 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | PQQ09_RS04775 | Protein ID | WP_000971655.1 |
Coordinates | 997799..998326 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | E8XL32 |
Locus tag | PQQ09_RS04780 | Protein ID | WP_000855692.1 |
Coordinates | 998323..998613 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ09_RS04755 (993099) | 993099..995666 | - | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
PQQ09_RS04760 (995825) | 995825..996346 | + | 522 | WP_024159753.1 | hypothetical protein | - |
PQQ09_RS04765 (996518) | 996518..997174 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
PQQ09_RS04770 (997521) | 997521..997726 | + | 206 | Protein_935 | IS5/IS1182 family transposase | - |
PQQ09_RS04775 (997799) | 997799..998326 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
PQQ09_RS04780 (998323) | 998323..998613 | - | 291 | WP_000855692.1 | DUF1778 domain-containing protein | Antitoxin |
PQQ09_RS04785 (998883) | 998883..999061 | - | 179 | Protein_938 | IS3 family transposase | - |
PQQ09_RS04790 (999302) | 999302..999628 | + | 327 | WP_000393302.1 | hypothetical protein | - |
PQQ09_RS04795 (999901) | 999901..1000248 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
PQQ09_RS04800 (1000233) | 1000233..1000682 | - | 450 | WP_000381610.1 | membrane protein | - |
PQQ09_RS04805 (1001113) | 1001113..1001556 | - | 444 | WP_000715092.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
PQQ09_RS04810 (1002013) | 1002013..1002663 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 997550..1007976 | 10426 | ||
flank | IS/Tn | - | - | 997550..997726 | 176 | ||
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 996518..1007976 | 11458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T271142 WP_000971655.1 NZ_CP117398:c998326-997799 [Salmonella enterica subsp. enterica serovar Typhimurium]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10678.57 Da Isoelectric Point: 8.5779
>AT271142 WP_000855692.1 NZ_CP117398:c998613-998323 [Salmonella enterica subsp. enterica serovar Typhimurium]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK9 | |
AlphaFold DB | A0A625WHV3 |