Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 850458..851083 | Replicon | chromosome |
Accession | NZ_CP117398 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain RM015 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | M7SD17 |
Locus tag | PQQ09_RS04115 | Protein ID | WP_000911336.1 |
Coordinates | 850685..851083 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | M7S3S8 |
Locus tag | PQQ09_RS04110 | Protein ID | WP_000557549.1 |
Coordinates | 850458..850685 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ09_RS04080 (845503) | 845503..847020 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
PQQ09_RS04085 (847096) | 847096..847641 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
PQQ09_RS04090 (847906) | 847906..848664 | + | 759 | WP_000244329.1 | amidase activator ActS | - |
PQQ09_RS04100 (848949) | 848949..849755 | - | 807 | WP_010989071.1 | DUF1460 domain-containing protein | - |
PQQ09_RS04105 (850030) | 850030..850281 | - | 252 | WP_001540858.1 | hypothetical protein | - |
PQQ09_RS04110 (850458) | 850458..850685 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PQQ09_RS04115 (850685) | 850685..851083 | + | 399 | WP_000911336.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PQQ09_RS04120 (851463) | 851463..851921 | + | 459 | WP_000502119.1 | IS200/IS605-like element IS200F family transposase | - |
PQQ09_RS04125 (852601) | 852601..853137 | + | 537 | WP_001038506.1 | STM3031 family outer membrane protein | - |
PQQ09_RS04130 (853184) | 853184..853816 | + | 633 | WP_000835265.1 | YfdX family protein | - |
PQQ09_RS04135 (854535) | 854535..855119 | + | 585 | WP_001244638.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 848949..860986 | 12037 | ||
flank | IS/Tn | - | - | 851463..851921 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14938.30 Da Isoelectric Point: 7.2155
>T271141 WP_000911336.1 NZ_CP117398:850685-851083 [Salmonella enterica subsp. enterica serovar Typhimurium]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6IFC | |
PDB | 6IFM |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6IFM | |
AlphaFold DB | A0A3V2Y5V5 |