Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1028033..1028847 | Replicon | chromosome |
Accession | NZ_CP117370 | ||
Organism | Salmonella enterica subsp. enterica serovar 4[5]12:i:- strain RM054 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | PQP97_RS04960 | Protein ID | WP_000971655.1 |
Coordinates | 1028033..1028560 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | E8XL32 |
Locus tag | PQP97_RS04965 | Protein ID | WP_000855692.1 |
Coordinates | 1028557..1028847 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP97_RS04940 (1023333) | 1023333..1025900 | - | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
PQP97_RS04945 (1026059) | 1026059..1026580 | + | 522 | WP_000858988.1 | hypothetical protein | - |
PQP97_RS04950 (1026752) | 1026752..1027408 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
PQP97_RS04955 (1027755) | 1027755..1027960 | + | 206 | Protein_972 | IS5/IS1182 family transposase | - |
PQP97_RS04960 (1028033) | 1028033..1028560 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
PQP97_RS04965 (1028557) | 1028557..1028847 | - | 291 | WP_000855692.1 | DUF1778 domain-containing protein | Antitoxin |
PQP97_RS04970 (1029117) | 1029117..1029295 | - | 179 | Protein_975 | IS3 family transposase | - |
PQP97_RS04975 (1029536) | 1029536..1029862 | + | 327 | WP_000393302.1 | hypothetical protein | - |
PQP97_RS04980 (1030135) | 1030135..1030482 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
PQP97_RS04985 (1030467) | 1030467..1030916 | - | 450 | WP_000381610.1 | membrane protein | - |
PQP97_RS04990 (1031347) | 1031347..1031790 | - | 444 | WP_000715092.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
PQP97_RS04995 (1032247) | 1032247..1032897 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 1027784..1027960 | 176 | ||
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1027784..1038210 | 10426 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T270872 WP_000971655.1 NZ_CP117370:c1028560-1028033 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10678.57 Da Isoelectric Point: 8.5779
>AT270872 WP_000855692.1 NZ_CP117370:c1028847-1028557 [Salmonella enterica subsp. enterica serovar 4,[5],12:i:-]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK9 | |
AlphaFold DB | A0A625WHV3 |