Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1025439..1026253 | Replicon | chromosome |
Accession | NZ_CP117357 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain RM096 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | PQQ15_RS04985 | Protein ID | WP_000971655.1 |
Coordinates | 1025439..1025966 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | E8XL32 |
Locus tag | PQQ15_RS04990 | Protein ID | WP_000855692.1 |
Coordinates | 1025963..1026253 (-) | Length | 97 a.a. |
Genomic Context
Location: 1023465..1023986 (522 bp)
Type: Others
Protein ID: WP_000858988.1
Type: Others
Protein ID: WP_000858988.1
Location: 1025161..1025366 (206 bp)
Type: Others
Protein ID: Protein_976
Type: Others
Protein ID: Protein_976
Location: 1026942..1027268 (327 bp)
Type: Others
Protein ID: WP_000393302.1
Type: Others
Protein ID: WP_000393302.1
Location: 1029653..1030303 (651 bp)
Type: Others
Protein ID: WP_001674874.1
Type: Others
Protein ID: WP_001674874.1
Location: 1020739..1023306 (2568 bp)
Type: Others
Protein ID: WP_001005807.1
Type: Others
Protein ID: WP_001005807.1
Location: 1024158..1024814 (657 bp)
Type: Others
Protein ID: WP_000420452.1
Type: Others
Protein ID: WP_000420452.1
Location: 1025439..1025966 (528 bp)
Type: Toxin
Protein ID: WP_000971655.1
Type: Toxin
Protein ID: WP_000971655.1
Location: 1025963..1026253 (291 bp)
Type: Antitoxin
Protein ID: WP_000855692.1
Type: Antitoxin
Protein ID: WP_000855692.1
Location: 1026523..1026701 (179 bp)
Type: Others
Protein ID: Protein_979
Type: Others
Protein ID: Protein_979
Location: 1027541..1027888 (348 bp)
Type: Others
Protein ID: WP_001669174.1
Type: Others
Protein ID: WP_001669174.1
Location: 1027873..1028322 (450 bp)
Type: Others
Protein ID: WP_000381610.1
Type: Others
Protein ID: WP_000381610.1
Location: 1028753..1029196 (444 bp)
Type: Others
Protein ID: WP_000715092.1
Type: Others
Protein ID: WP_000715092.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ15_RS04965 (1020739) | 1020739..1023306 | - | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
PQQ15_RS04970 (1023465) | 1023465..1023986 | + | 522 | WP_000858988.1 | hypothetical protein | - |
PQQ15_RS04975 (1024158) | 1024158..1024814 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
PQQ15_RS04980 (1025161) | 1025161..1025366 | + | 206 | Protein_976 | IS5/IS1182 family transposase | - |
PQQ15_RS04985 (1025439) | 1025439..1025966 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
PQQ15_RS04990 (1025963) | 1025963..1026253 | - | 291 | WP_000855692.1 | DUF1778 domain-containing protein | Antitoxin |
PQQ15_RS04995 (1026523) | 1026523..1026701 | - | 179 | Protein_979 | IS3 family transposase | - |
PQQ15_RS05000 (1026942) | 1026942..1027268 | + | 327 | WP_000393302.1 | hypothetical protein | - |
PQQ15_RS05005 (1027541) | 1027541..1027888 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
PQQ15_RS05010 (1027873) | 1027873..1028322 | - | 450 | WP_000381610.1 | membrane protein | - |
PQQ15_RS05015 (1028753) | 1028753..1029196 | - | 444 | WP_000715092.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
PQQ15_RS05020 (1029653) | 1029653..1030303 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1025190..1035616 | 10426 | ||
flank | IS/Tn | - | - | 1025190..1025366 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T270767 WP_000971655.1 NZ_CP117357:c1025966-1025439 [Salmonella enterica subsp. enterica serovar Typhimurium]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10678.57 Da Isoelectric Point: 8.5779
>AT270767 WP_000855692.1 NZ_CP117357:c1026253-1025963 [Salmonella enterica subsp. enterica serovar Typhimurium]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp