Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 849197..849822 | Replicon | chromosome |
Accession | NZ_CP117338 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain RM095 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PQP94_RS04110 | Protein ID | WP_274895861.1 |
Coordinates | 849424..849822 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | M7S3S8 |
Locus tag | PQP94_RS04105 | Protein ID | WP_000557549.1 |
Coordinates | 849197..849424 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP94_RS04075 (844242) | 844242..845759 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
PQP94_RS04080 (845835) | 845835..846380 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
PQP94_RS04085 (846645) | 846645..847403 | + | 759 | WP_000244329.1 | amidase activator ActS | - |
PQP94_RS04095 (847688) | 847688..848494 | - | 807 | WP_010989071.1 | DUF1460 domain-containing protein | - |
PQP94_RS04100 (848769) | 848769..849020 | - | 252 | WP_001540858.1 | hypothetical protein | - |
PQP94_RS04105 (849197) | 849197..849424 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PQP94_RS04110 (849424) | 849424..849822 | + | 399 | WP_274895861.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PQP94_RS04115 (850628) | 850628..851164 | + | 537 | WP_001038506.1 | STM3031 family outer membrane protein | - |
PQP94_RS04120 (851211) | 851211..851843 | + | 633 | WP_000835265.1 | YfdX family protein | - |
PQP94_RS04125 (852562) | 852562..853146 | + | 585 | WP_001244638.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 847688..859013 | 11325 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14880.26 Da Isoelectric Point: 7.7784
>T270610 WP_274895861.1 NZ_CP117338:849424-849822 [Salmonella enterica subsp. enterica serovar Typhimurium]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVAGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVAGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|