Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 990330..991144 | Replicon | chromosome |
Accession | NZ_CP117244 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain ATCC 14028 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | PQQ30_RS04745 | Protein ID | WP_000971655.1 |
Coordinates | 990330..990857 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | E8XL32 |
Locus tag | PQQ30_RS04750 | Protein ID | WP_000855692.1 |
Coordinates | 990854..991144 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQQ30_RS04725 (985630) | 985630..988197 | - | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
PQQ30_RS04730 (988356) | 988356..988877 | + | 522 | WP_000858988.1 | hypothetical protein | - |
PQQ30_RS04735 (989049) | 989049..989705 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
PQQ30_RS04740 (990052) | 990052..990257 | + | 206 | Protein_929 | IS5/IS1182 family transposase | - |
PQQ30_RS04745 (990330) | 990330..990857 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
PQQ30_RS04750 (990854) | 990854..991144 | - | 291 | WP_000855692.1 | DUF1778 domain-containing protein | Antitoxin |
PQQ30_RS04755 (991414) | 991414..991592 | - | 179 | Protein_932 | IS3 family transposase | - |
PQQ30_RS04760 (991833) | 991833..992159 | + | 327 | WP_000393302.1 | hypothetical protein | - |
PQQ30_RS04765 (992432) | 992432..992779 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
PQQ30_RS04770 (992764) | 992764..993213 | - | 450 | WP_000381610.1 | membrane protein | - |
PQQ30_RS04775 (993644) | 993644..994087 | - | 444 | WP_000715092.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
PQQ30_RS04780 (994544) | 994544..995194 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 990081..1000507 | 10426 | ||
flank | IS/Tn | - | - | 990081..990257 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T270172 WP_000971655.1 NZ_CP117244:c990857-990330 [Salmonella enterica subsp. enterica serovar Typhimurium]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10678.57 Da Isoelectric Point: 8.5779
>AT270172 WP_000855692.1 NZ_CP117244:c991144-990854 [Salmonella enterica subsp. enterica serovar Typhimurium]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK9 | |
AlphaFold DB | A0A625WHV3 |