Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3861864..3862489 | Replicon | chromosome |
Accession | NZ_CP117184 | ||
Organism | Salmonella enterica subsp. enterica strain 123 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | M7SD17 |
Locus tag | PQ453_RS19110 | Protein ID | WP_000911336.1 |
Coordinates | 3861864..3862262 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | M7S3S8 |
Locus tag | PQ453_RS19115 | Protein ID | WP_000557549.1 |
Coordinates | 3862262..3862489 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQ453_RS19095 (3858540) | 3858540..3859124 | - | 585 | WP_001244638.1 | fimbrial protein | - |
PQ453_RS19100 (3859843) | 3859843..3860475 | - | 633 | WP_000835265.1 | YfdX family protein | - |
PQ453_RS19105 (3860522) | 3860522..3861058 | - | 537 | WP_001038506.1 | STM3031 family outer membrane protein | - |
PQ453_RS19110 (3861864) | 3861864..3862262 | - | 399 | WP_000911336.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PQ453_RS19115 (3862262) | 3862262..3862489 | - | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PQ453_RS19120 (3862666) | 3862666..3862917 | + | 252 | WP_001540858.1 | hypothetical protein | - |
PQ453_RS19125 (3863192) | 3863192..3863998 | + | 807 | WP_010989071.1 | DUF1460 domain-containing protein | - |
PQ453_RS19135 (3864283) | 3864283..3865041 | - | 759 | WP_000244329.1 | amidase activator ActS | - |
PQ453_RS19140 (3865306) | 3865306..3865851 | + | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
PQ453_RS19145 (3865927) | 3865927..3867444 | - | 1518 | WP_273692499.1 | lysine--tRNA ligase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 3853418..3863998 | 10580 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14938.30 Da Isoelectric Point: 7.2155
>T270051 WP_000911336.1 NZ_CP117184:c3862262-3861864 [Salmonella enterica subsp. enterica]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6IFC | |
PDB | 6IFM |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6IFM | |
AlphaFold DB | A0A3V2Y5V5 |