Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1027707..1028521 | Replicon | chromosome |
Accession | NZ_CP117033 | ||
Organism | Salmonella enterica strain PIW95_S14_0299 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | PQP07_RS04955 | Protein ID | WP_000971655.1 |
Coordinates | 1027707..1028234 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | E8XL32 |
Locus tag | PQP07_RS04960 | Protein ID | WP_000855692.1 |
Coordinates | 1028231..1028521 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP07_RS04935 (1023007) | 1023007..1025574 | - | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
PQP07_RS04940 (1025733) | 1025733..1026254 | + | 522 | WP_000858988.1 | hypothetical protein | - |
PQP07_RS04945 (1026426) | 1026426..1027082 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
PQP07_RS04950 (1027429) | 1027429..1027634 | + | 206 | Protein_971 | IS5/IS1182 family transposase | - |
PQP07_RS04955 (1027707) | 1027707..1028234 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
PQP07_RS04960 (1028231) | 1028231..1028521 | - | 291 | WP_000855692.1 | DUF1778 domain-containing protein | Antitoxin |
PQP07_RS04965 (1028791) | 1028791..1028969 | - | 179 | Protein_974 | IS3 family transposase | - |
PQP07_RS04970 (1029210) | 1029210..1029536 | + | 327 | WP_000393302.1 | hypothetical protein | - |
PQP07_RS04975 (1029809) | 1029809..1030156 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
PQP07_RS04980 (1030141) | 1030141..1030590 | - | 450 | WP_000381610.1 | membrane protein | - |
PQP07_RS04985 (1031021) | 1031021..1031464 | - | 444 | WP_000715092.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
PQP07_RS04990 (1031921) | 1031921..1032571 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1027458..1037884 | 10426 | ||
flank | IS/Tn | - | - | 1027458..1027634 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T269884 WP_000971655.1 NZ_CP117033:c1028234-1027707 [Salmonella enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK9 | |
AlphaFold DB | A0A625WHV3 |