Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 880877..881502 | Replicon | chromosome |
Accession | NZ_CP117033 | ||
Organism | Salmonella enterica strain PIW95_S14_0299 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | M7SD17 |
Locus tag | PQP07_RS04300 | Protein ID | WP_000911336.1 |
Coordinates | 881104..881502 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | M7S3S8 |
Locus tag | PQP07_RS04295 | Protein ID | WP_000557549.1 |
Coordinates | 880877..881104 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PQP07_RS04265 (875922) | 875922..877439 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
PQP07_RS04270 (877515) | 877515..878060 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
PQP07_RS04275 (878325) | 878325..879083 | + | 759 | WP_000244329.1 | amidase activator ActS | - |
PQP07_RS04285 (879368) | 879368..880174 | - | 807 | WP_010989071.1 | DUF1460 domain-containing protein | - |
PQP07_RS04290 (880449) | 880449..880700 | - | 252 | WP_001540858.1 | hypothetical protein | - |
PQP07_RS04295 (880877) | 880877..881104 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PQP07_RS04300 (881104) | 881104..881502 | + | 399 | WP_000911336.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PQP07_RS04305 (882308) | 882308..882844 | + | 537 | WP_001038506.1 | STM3031 family outer membrane protein | - |
PQP07_RS04310 (882891) | 882891..883523 | + | 633 | WP_000835265.1 | YfdX family protein | - |
PQP07_RS04315 (884242) | 884242..884826 | + | 585 | WP_001244638.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 879368..890693 | 11325 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14938.30 Da Isoelectric Point: 7.2155
>T269883 WP_000911336.1 NZ_CP117033:881104-881502 [Salmonella enterica]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6IFC | |
PDB | 6IFM |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6IFM | |
AlphaFold DB | A0A3V2Y5V5 |