Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 4097697..4098391 | Replicon | chromosome |
| Accession | NZ_CP117001 | ||
| Organism | Escherichia coli strain MLI108K2 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q47157 |
| Locus tag | NL410_RS21830 | Protein ID | WP_001263489.1 |
| Coordinates | 4097993..4098391 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | NL410_RS21825 | Protein ID | WP_000554758.1 |
| Coordinates | 4097697..4097990 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NL410_RS21805 (4093329) | 4093329..4093826 | + | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
| NL410_RS21810 (4094050) | 4094050..4095762 | - | 1713 | Protein_3909 | flagellar biosynthesis protein FlhA | - |
| NL410_RS21815 (4095734) | 4095734..4096519 | + | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
| NL410_RS21820 (4096590) | 4096590..4097645 | + | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| NL410_RS21825 (4097697) | 4097697..4097990 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| NL410_RS21830 (4097993) | 4097993..4098391 | + | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| NL410_RS21835 (4098401) | 4098401..4098853 | + | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
| NL410_RS21840 (4099171) | 4099171..4099377 | + | 207 | Protein_3915 | RtcB family protein | - |
| NL410_RS21845 (4099373) | 4099373..4099894 | + | 522 | Protein_3916 | peptide chain release factor H | - |
| NL410_RS21850 (4099951) | 4099951..4101408 | - | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
| NL410_RS21855 (4101669) | 4101669..4102127 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| - (4102723) | 4102723..4102803 | + | 81 | NuclAT_11 | - | - |
| - (4102723) | 4102723..4102803 | + | 81 | NuclAT_11 | - | - |
| - (4102723) | 4102723..4102803 | + | 81 | NuclAT_11 | - | - |
| - (4102723) | 4102723..4102803 | + | 81 | NuclAT_11 | - | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | gmhA/lpcA | 4083934..4099894 | 15960 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T269726 WP_001263489.1 NZ_CP117001:4097993-4098391 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A090J8B1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |