Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 4097061..4097755 | Replicon | chromosome |
Accession | NZ_CP116994 | ||
Organism | Escherichia coli strain MLI108K1 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | NL409_RS21815 | Protein ID | WP_001263489.1 |
Coordinates | 4097357..4097755 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | NL409_RS21810 | Protein ID | WP_000554758.1 |
Coordinates | 4097061..4097354 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL409_RS21790 (4092693) | 4092693..4093190 | + | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
NL409_RS21795 (4093414) | 4093414..4095126 | - | 1713 | Protein_3906 | flagellar biosynthesis protein FlhA | - |
NL409_RS21800 (4095098) | 4095098..4095883 | + | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
NL409_RS21805 (4095954) | 4095954..4097009 | + | 1056 | WP_001226164.1 | DNA polymerase IV | - |
NL409_RS21810 (4097061) | 4097061..4097354 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
NL409_RS21815 (4097357) | 4097357..4097755 | + | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
NL409_RS21820 (4097765) | 4097765..4098217 | + | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
NL409_RS21825 (4098535) | 4098535..4098741 | + | 207 | Protein_3912 | RtcB family protein | - |
NL409_RS21830 (4098737) | 4098737..4099258 | + | 522 | Protein_3913 | peptide chain release factor H | - |
NL409_RS21835 (4099315) | 4099315..4100772 | - | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
NL409_RS21840 (4101033) | 4101033..4101491 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
- (4102087) | 4102087..4102167 | + | 81 | NuclAT_11 | - | - |
- (4102087) | 4102087..4102167 | + | 81 | NuclAT_11 | - | - |
- (4102087) | 4102087..4102167 | + | 81 | NuclAT_11 | - | - |
- (4102087) | 4102087..4102167 | + | 81 | NuclAT_11 | - | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | gmhA/lpcA | 4083298..4099258 | 15960 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T269695 WP_001263489.1 NZ_CP116994:4097357-4097755 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |