Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1024342..1025156 | Replicon | chromosome |
Accession | NZ_CP113541 | ||
Organism | Salmonella enterica strain CHC |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | OXV05_RS04875 | Protein ID | WP_000971655.1 |
Coordinates | 1024342..1024869 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | E8XL32 |
Locus tag | OXV05_RS04880 | Protein ID | WP_000855692.1 |
Coordinates | 1024866..1025156 (-) | Length | 97 a.a. |
Genomic Context
Location: 1022368..1022889 (522 bp)
Type: Others
Protein ID: WP_000858988.1
Type: Others
Protein ID: WP_000858988.1
Location: 1024064..1024269 (206 bp)
Type: Others
Protein ID: Protein_955
Type: Others
Protein ID: Protein_955
Location: 1025845..1026171 (327 bp)
Type: Others
Protein ID: WP_000393302.1
Type: Others
Protein ID: WP_000393302.1
Location: 1028556..1029206 (651 bp)
Type: Others
Protein ID: WP_001674874.1
Type: Others
Protein ID: WP_001674874.1
Location: 1019642..1022209 (2568 bp)
Type: Others
Protein ID: WP_198903237.1
Type: Others
Protein ID: WP_198903237.1
Location: 1023061..1023717 (657 bp)
Type: Others
Protein ID: WP_000420452.1
Type: Others
Protein ID: WP_000420452.1
Location: 1024342..1024869 (528 bp)
Type: Toxin
Protein ID: WP_000971655.1
Type: Toxin
Protein ID: WP_000971655.1
Location: 1024866..1025156 (291 bp)
Type: Antitoxin
Protein ID: WP_000855692.1
Type: Antitoxin
Protein ID: WP_000855692.1
Location: 1025426..1025604 (179 bp)
Type: Others
Protein ID: Protein_958
Type: Others
Protein ID: Protein_958
Location: 1026444..1026791 (348 bp)
Type: Others
Protein ID: WP_001669174.1
Type: Others
Protein ID: WP_001669174.1
Location: 1026776..1027225 (450 bp)
Type: Others
Protein ID: WP_000381610.1
Type: Others
Protein ID: WP_000381610.1
Location: 1027656..1028099 (444 bp)
Type: Others
Protein ID: WP_000715092.1
Type: Others
Protein ID: WP_000715092.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV05_RS04855 (1019642) | 1019642..1022209 | - | 2568 | WP_198903237.1 | DNA mismatch repair protein MutS | - |
OXV05_RS04860 (1022368) | 1022368..1022889 | + | 522 | WP_000858988.1 | hypothetical protein | - |
OXV05_RS04865 (1023061) | 1023061..1023717 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
OXV05_RS04870 (1024064) | 1024064..1024269 | + | 206 | Protein_955 | IS5/IS1182 family transposase | - |
OXV05_RS04875 (1024342) | 1024342..1024869 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
OXV05_RS04880 (1024866) | 1024866..1025156 | - | 291 | WP_000855692.1 | DUF1778 domain-containing protein | Antitoxin |
OXV05_RS04885 (1025426) | 1025426..1025604 | - | 179 | Protein_958 | IS3 family transposase | - |
OXV05_RS04890 (1025845) | 1025845..1026171 | + | 327 | WP_000393302.1 | hypothetical protein | - |
OXV05_RS04895 (1026444) | 1026444..1026791 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
OXV05_RS04900 (1026776) | 1026776..1027225 | - | 450 | WP_000381610.1 | membrane protein | - |
OXV05_RS04905 (1027656) | 1027656..1028099 | - | 444 | WP_000715092.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
OXV05_RS04910 (1028556) | 1028556..1029206 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1024093..1034519 | 10426 | ||
flank | IS/Tn | - | - | 1024093..1024269 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T266011 WP_000971655.1 NZ_CP113541:c1024869-1024342 [Salmonella enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp