Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1024214..1025028 | Replicon | chromosome |
| Accession | NZ_CP113538 | ||
| Organism | Salmonella enterica strain XSK | ||
Toxin (Protein)
| Gene name | TacT3 | Uniprot ID | Q57KM2 |
| Locus tag | OXV06_RS04875 | Protein ID | WP_000971655.1 |
| Coordinates | 1024214..1024741 (-) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | TacA3 | Uniprot ID | E8XL32 |
| Locus tag | OXV06_RS04880 | Protein ID | WP_000855692.1 |
| Coordinates | 1024738..1025028 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OXV06_RS04855 (1019514) | 1019514..1022081 | - | 2568 | WP_198903237.1 | DNA mismatch repair protein MutS | - |
| OXV06_RS04860 (1022240) | 1022240..1022761 | + | 522 | WP_000858988.1 | hypothetical protein | - |
| OXV06_RS04865 (1022933) | 1022933..1023589 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
| OXV06_RS04870 (1023936) | 1023936..1024141 | + | 206 | Protein_955 | IS5/IS1182 family transposase | - |
| OXV06_RS04875 (1024214) | 1024214..1024741 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
| OXV06_RS04880 (1024738) | 1024738..1025028 | - | 291 | WP_000855692.1 | DUF1778 domain-containing protein | Antitoxin |
| OXV06_RS04885 (1025298) | 1025298..1025476 | - | 179 | Protein_958 | IS3 family transposase | - |
| OXV06_RS04890 (1025717) | 1025717..1026043 | + | 327 | WP_000393302.1 | hypothetical protein | - |
| OXV06_RS04895 (1026316) | 1026316..1026663 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
| OXV06_RS04900 (1026648) | 1026648..1027097 | - | 450 | WP_000381610.1 | membrane protein | - |
| OXV06_RS04905 (1027528) | 1027528..1027971 | - | 444 | WP_000715092.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
| OXV06_RS04910 (1028428) | 1028428..1029078 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1024214..1034391 | 10177 | ||
| inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1023965..1034391 | 10426 | ||
| flank | IS/Tn | - | - | 1023965..1024141 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T265955 WP_000971655.1 NZ_CP113538:c1024741-1024214 [Salmonella enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6G96 | |
| PDB | 7AK9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK9 | |
| AlphaFold DB | A0A625WHV3 |