Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1029353..1030167 | Replicon | chromosome |
Accession | NZ_CP113536 | ||
Organism | Salmonella enterica strain ZCX |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | A0A3Z5UEC2 |
Locus tag | OXV07_RS04980 | Protein ID | WP_023198251.1 |
Coordinates | 1029353..1029880 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | E8XL32 |
Locus tag | OXV07_RS04985 | Protein ID | WP_000855692.1 |
Coordinates | 1029877..1030167 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV07_RS04960 (1024653) | 1024653..1027220 | - | 2568 | WP_023139136.1 | DNA mismatch repair protein MutS | - |
OXV07_RS04965 (1027379) | 1027379..1027900 | + | 522 | WP_000858988.1 | hypothetical protein | - |
OXV07_RS04970 (1028072) | 1028072..1028728 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
OXV07_RS04975 (1029075) | 1029075..1029280 | + | 206 | Protein_976 | IS5/IS1182 family transposase | - |
OXV07_RS04980 (1029353) | 1029353..1029880 | - | 528 | WP_023198251.1 | GNAT family N-acetyltransferase | Toxin |
OXV07_RS04985 (1029877) | 1029877..1030167 | - | 291 | WP_000855692.1 | DUF1778 domain-containing protein | Antitoxin |
OXV07_RS04990 (1030437) | 1030437..1030615 | - | 179 | Protein_979 | IS3 family transposase | - |
OXV07_RS04995 (1030856) | 1030856..1031182 | + | 327 | WP_000393302.1 | hypothetical protein | - |
OXV07_RS05000 (1031455) | 1031455..1031802 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
OXV07_RS05005 (1031787) | 1031787..1032236 | - | 450 | WP_000381610.1 | membrane protein | - |
OXV07_RS05010 (1032667) | 1032667..1033110 | - | 444 | WP_000715092.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
OXV07_RS05015 (1033567) | 1033567..1034217 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1029104..1039530 | 10426 | ||
flank | IS/Tn | - | - | 1029104..1029280 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19127.94 Da Isoelectric Point: 9.3903
>T265921 WP_023198251.1 NZ_CP113536:c1029880-1029353 [Salmonella enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPDAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPDAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z5UEC2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A625WHV3 |