Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1108733..1109547 | Replicon | chromosome |
Accession | NZ_CP113535 | ||
Organism | Salmonella enterica strain ZLQ |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | OXV11_RS05380 | Protein ID | WP_000971655.1 |
Coordinates | 1108733..1109260 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | E8XL32 |
Locus tag | OXV11_RS05385 | Protein ID | WP_000855692.1 |
Coordinates | 1109257..1109547 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OXV11_RS05360 (1104033) | 1104033..1106600 | - | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
OXV11_RS05365 (1106759) | 1106759..1107280 | + | 522 | WP_000858988.1 | hypothetical protein | - |
OXV11_RS05370 (1107452) | 1107452..1108108 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
OXV11_RS05375 (1108455) | 1108455..1108660 | + | 206 | Protein_1056 | IS5/IS1182 family transposase | - |
OXV11_RS05380 (1108733) | 1108733..1109260 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
OXV11_RS05385 (1109257) | 1109257..1109547 | - | 291 | WP_000855692.1 | DUF1778 domain-containing protein | Antitoxin |
OXV11_RS05390 (1109817) | 1109817..1109995 | - | 179 | Protein_1059 | IS3 family transposase | - |
OXV11_RS05395 (1110236) | 1110236..1110562 | + | 327 | WP_000393302.1 | hypothetical protein | - |
OXV11_RS05400 (1110835) | 1110835..1111182 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
OXV11_RS05405 (1111167) | 1111167..1111616 | - | 450 | WP_000381610.1 | membrane protein | - |
OXV11_RS05410 (1112047) | 1112047..1112490 | - | 444 | WP_000715092.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
OXV11_RS05415 (1112947) | 1112947..1113597 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1108484..1118910 | 10426 | ||
flank | IS/Tn | - | - | 1108484..1108660 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T265902 WP_000971655.1 NZ_CP113535:c1109260-1108733 [Salmonella enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK9 | |
AlphaFold DB | A0A625WHV3 |