Detailed information of TA system TA265902

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): tacAT/DUF1778(antitoxin)
• Location: 1108733..1109547
• Replicon: chromosome
• Accession: NZ_CP113535
• Organism: Salmonella enterica strain ZLQ

Toxin (Protein)

• Gene name: TacT3
• Uniprot ID: Q57KM2
• Locus tag: OXV11_RS05380
• Protein ID: WP_000971655.1
• Coordinates: 1108733..1109260 (-)
• Length: 176 a.a.

Antitoxin (Protein)

• Gene name: TacA3
• Uniprot ID: E8XL32
• Locus tag: OXV11_RS05385
• Protein ID: WP_000855692.1
• Coordinates: 1109257..1109547 (-)
• Length: 97 a.a.

Genomic Context

Location: 1106759..1107280 (522 bp)
Type: Others
Protein ID: WP_000858988.1

Location: 1108455..1108660 (206 bp)
Type: Others
Protein ID: Protein_1056

Location: 1110236..1110562 (327 bp)
Type: Others
Protein ID: WP_000393302.1

Location: 1112947..1113597 (651 bp)
Type: Others
Protein ID: WP_001674874.1

Location: 1104033..1106600 (2568 bp)
Type: Others
Protein ID: WP_001005807.1

Location: 1107452..1108108 (657 bp)
Type: Others
Protein ID: WP_000420452.1

Location: 1108733..1109260 (528 bp)
Type: Toxin
Protein ID: WP_000971655.1

Location: 1109257..1109547 (291 bp)
Type: Antitoxin
Protein ID: WP_000855692.1

Location: 1109817..1109995 (179 bp)
Type: Others
Protein ID: Protein_1059

Location: 1110835..1111182 (348 bp)
Type: Others
Protein ID: WP_001669174.1

Location: 1111167..1111616 (450 bp)
Type: Others
Protein ID: WP_000381610.1

Location: 1112047..1112490 (444 bp)
Type: Others
Protein ID: WP_000715092.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
OXV11_RS05360 (1104033)	1104033..1106600	-	2568	WP_001005807.1	DNA mismatch repair protein MutS	-
OXV11_RS05365 (1106759)	1106759..1107280	+	522	WP_000858988.1	hypothetical protein	-
OXV11_RS05370 (1107452)	1107452..1108108	-	657	WP_000420452.1	protein-serine/threonine phosphatase	-
OXV11_RS05375 (1108455)	1108455..1108660	+	206	Protein_1056	IS5/IS1182 family transposase	-
OXV11_RS05380 (1108733)	1108733..1109260	-	528	WP_000971655.1	GNAT family N-acetyltransferase	Toxin
OXV11_RS05385 (1109257)	1109257..1109547	-	291	WP_000855692.1	DUF1778 domain-containing protein	Antitoxin
OXV11_RS05390 (1109817)	1109817..1109995	-	179	Protein_1059	IS3 family transposase	-
OXV11_RS05395 (1110236)	1110236..1110562	+	327	WP_000393302.1	hypothetical protein	-
OXV11_RS05400 (1110835)	1110835..1111182	-	348	WP_001669174.1	DUF1493 family protein	-
OXV11_RS05405 (1111167)	1111167..1111616	-	450	WP_000381610.1	membrane protein	-
OXV11_RS05410 (1112047)	1112047..1112490	-	444	WP_000715092.1	SPI-1 type III secretion system invasion lipoprotein InvH	-
OXV11_RS05415 (1112947)	1112947..1113597	+	651	WP_001674874.1	type III secretion system transcriptional activator InvF	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View UFRD01000002 Salmonella enterica subsp. enterica serovar Typhimurium strain NCTC12023 Genomic island TA010052 4599654..4610080 0	inside	Genomic island	-	invH / invF / invG / invE / invA / invB	1108484..1118910	10426
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_016810 Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 IS/Tn TA025955 3070795..3070971 0 View NC_016856 Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S IS/Tn TA026055 3068456..3068632 0 View UFRD01000002 Salmonella enterica subsp. enterica serovar Typhimurium strain NCTC12023 IS/Tn TA010052 4599654..4599830 0	flank	IS/Tn	-	-	1108484..1108660	176

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Antitoxin

• Vibrio phage ICP1, Orf50 (1-95)

Sequences

Toxin

Protein

• Length: 176 a.a.
• Molecular weight: 19069.91 Da
• Isoelectric Point: 9.6420

>T265902 WP_000971655.1 NZ_CP113535:c1109260-1108733 [Salmonella enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL

Nucleotide

• Length: 528 bp

Antitoxin

Protein

• Length: 97 a.a.
• Molecular weight: 10678.57 Da
• Isoelectric Point: 8.5779

>AT265902 WP_000855692.1 NZ_CP113535:c1109547-1109257 [Salmonella enterica]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK

Nucleotide

• Length: 291 bp

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• PDB: 6G96
• PDB: 7AK9

Antitoxin

Loading, please wait

• PDB: 7AK9
• AlphaFold DB: A0A625WHV3