Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-MW1433/- |
Location | 334524..334831 | Replicon | chromosome |
Accession | NZ_CP113039 | ||
Organism | Staphylococcus aureus strain Gwen |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | OS086_RS01800 | Protein ID | WP_011447039.1 |
Coordinates | 334655..334831 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | MW1433 | ||
Locus tag | - | ||
Coordinates | 334524..334663 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OS086_RS01760 (329869) | 329869..330129 | + | 261 | WP_001791826.1 | hypothetical protein | - |
OS086_RS01765 (330182) | 330182..330532 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
OS086_RS01770 (331215) | 331215..331664 | + | 450 | WP_000727645.1 | chemotaxis-inhibiting protein CHIPS | - |
OS086_RS01775 (331759) | 331759..332093 | - | 335 | Protein_317 | SH3 domain-containing protein | - |
OS086_RS01780 (332740) | 332740..333231 | - | 492 | WP_000920042.1 | staphylokinase | - |
OS086_RS01785 (333422) | 333422..334177 | - | 756 | WP_000861026.1 | CHAP domain-containing protein | - |
OS086_RS01790 (334189) | 334189..334443 | - | 255 | WP_000611512.1 | phage holin | - |
OS086_RS01795 (334495) | 334495..334602 | + | 108 | WP_031762631.1 | hypothetical protein | - |
- (334524) | 334524..334663 | + | 140 | NuclAT_0 | - | Antitoxin |
- (334524) | 334524..334663 | + | 140 | NuclAT_0 | - | Antitoxin |
- (334524) | 334524..334663 | + | 140 | NuclAT_0 | - | Antitoxin |
- (334524) | 334524..334663 | + | 140 | NuclAT_0 | - | Antitoxin |
OS086_RS01800 (334655) | 334655..334831 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
OS086_RS01805 (335034) | 335034..335807 | - | 774 | WP_025174055.1 | staphylococcal enterotoxin type P | - |
OS086_RS01810 (336228) | 336228..336602 | - | 375 | WP_000340977.1 | hypothetical protein | - |
OS086_RS01815 (336658) | 336658..336945 | - | 288 | WP_001262621.1 | hypothetical protein | - |
OS086_RS01820 (336991) | 336991..337143 | - | 153 | WP_001000058.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | scn / chp / sak / see / hlb / sell / sec / tsst-1 / groEL | 330182..397972 | 67790 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T265256 WP_011447039.1 NZ_CP113039:c334831-334655 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
Antitoxin
Download Length: 140 bp
>AT265256 NZ_CP113039:334524-334663 [Staphylococcus aureus]
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
ATATATAGAAAAAGGGCAACATGCGCAAACATGTTACCCTAGTGAGCCCGTTAAAAAGACGGTGGCTATTTTAGATTAAA
GATTAAATTAATAACCATTTAACCATCGAAACCAGCCAAAGTTAGCGATGGTTATTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|