Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1233728..1234353 | Replicon | chromosome |
| Accession | NZ_CP110657 | ||
| Organism | Salmonella enterica subsp. enterica strain S2122 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | M7SD17 |
| Locus tag | OOK64_RS06240 | Protein ID | WP_000911336.1 |
| Coordinates | 1233728..1234126 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | M7S3S8 |
| Locus tag | OOK64_RS06245 | Protein ID | WP_000557549.1 |
| Coordinates | 1234126..1234353 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OOK64_RS06225 (1230404) | 1230404..1230988 | - | 585 | WP_001244638.1 | fimbrial protein | - |
| OOK64_RS06230 (1231707) | 1231707..1232339 | - | 633 | WP_000835265.1 | YfdX family protein | - |
| OOK64_RS06235 (1232386) | 1232386..1232922 | - | 537 | WP_001038506.1 | STM3031 family outer membrane protein | - |
| OOK64_RS06240 (1233728) | 1233728..1234126 | - | 399 | WP_000911336.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| OOK64_RS06245 (1234126) | 1234126..1234353 | - | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| OOK64_RS06250 (1234530) | 1234530..1234781 | + | 252 | WP_001540858.1 | hypothetical protein | - |
| OOK64_RS06255 (1235056) | 1235056..1235862 | + | 807 | WP_010989071.1 | DUF1460 domain-containing protein | - |
| OOK64_RS06265 (1236147) | 1236147..1236905 | - | 759 | WP_000244329.1 | amidase activator ActS | - |
| OOK64_RS06270 (1237170) | 1237170..1237715 | + | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
| OOK64_RS06275 (1237791) | 1237791..1239308 | - | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 1225282..1235862 | 10580 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14938.30 Da Isoelectric Point: 7.2155
>T264086 WP_000911336.1 NZ_CP110657:c1234126-1233728 [Salmonella enterica subsp. enterica]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6IFC | |
| PDB | 6IFM |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6IFM | |
| AlphaFold DB | A0A3V2Y5V5 |