Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1027891..1028705 | Replicon | chromosome |
Accession | NZ_CP110201 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhimurium strain 1104-65 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | OCK73_RS04950 | Protein ID | WP_000971655.1 |
Coordinates | 1027891..1028418 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | E8XL32 |
Locus tag | OCK73_RS04955 | Protein ID | WP_000855692.1 |
Coordinates | 1028415..1028705 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OCK73_RS04930 (1023191) | 1023191..1025758 | - | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
OCK73_RS04935 (1025917) | 1025917..1026438 | + | 522 | WP_000858988.1 | hypothetical protein | - |
OCK73_RS04940 (1026610) | 1026610..1027266 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
OCK73_RS04945 (1027613) | 1027613..1027818 | + | 206 | Protein_970 | IS5/IS1182 family transposase | - |
OCK73_RS04950 (1027891) | 1027891..1028418 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
OCK73_RS04955 (1028415) | 1028415..1028705 | - | 291 | WP_000855692.1 | DUF1778 domain-containing protein | Antitoxin |
OCK73_RS04960 (1028975) | 1028975..1029153 | - | 179 | Protein_973 | IS3 family transposase | - |
OCK73_RS04965 (1029394) | 1029394..1029720 | + | 327 | WP_000393302.1 | hypothetical protein | - |
OCK73_RS04970 (1029993) | 1029993..1030340 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
OCK73_RS04975 (1030325) | 1030325..1030774 | - | 450 | WP_000381610.1 | membrane protein | - |
OCK73_RS04980 (1031205) | 1031205..1031648 | - | 444 | WP_000715092.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
OCK73_RS04985 (1032105) | 1032105..1032755 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1027642..1038068 | 10426 | ||
flank | IS/Tn | - | - | 1027642..1027818 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T263415 WP_000971655.1 NZ_CP110201:c1028418-1027891 [Salmonella enterica subsp. enterica serovar Typhimurium]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10678.57 Da Isoelectric Point: 8.5779
>AT263415 WP_000855692.1 NZ_CP110201:c1028705-1028415 [Salmonella enterica subsp. enterica serovar Typhimurium]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNILPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK9 | |
AlphaFold DB | A0A625WHV3 |