Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 995154..995848 | Replicon | chromosome |
Accession | NZ_CP104114 | ||
Organism | Escherichia coli strain USDA-ARS-USMARC-51408 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | A0A3P5GWS5 |
Locus tag | N1706_RS04630 | Protein ID | WP_001263488.1 |
Coordinates | 995450..995848 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | N1706_RS04625 | Protein ID | WP_000554758.1 |
Coordinates | 995154..995447 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N1706_RS04605 (990786) | 990786..991283 | + | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
N1706_RS04610 (991507) | 991507..993219 | - | 1713 | Protein_879 | flagellar biosynthesis protein FlhA | - |
N1706_RS04615 (993191) | 993191..993976 | + | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
N1706_RS04620 (994047) | 994047..995102 | + | 1056 | WP_001226164.1 | DNA polymerase IV | - |
N1706_RS04625 (995154) | 995154..995447 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
N1706_RS04630 (995450) | 995450..995848 | + | 399 | WP_001263488.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
N1706_RS04635 (995858) | 995858..996310 | + | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
N1706_RS04640 (996628) | 996628..996834 | + | 207 | Protein_885 | RtcB family protein | - |
N1706_RS04645 (996830) | 996830..997351 | + | 522 | Protein_886 | peptide chain release factor H | - |
N1706_RS04650 (997408) | 997408..998865 | - | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
N1706_RS04655 (999126) | 999126..999584 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
- (1000180) | 1000180..1000260 | + | 81 | NuclAT_11 | - | - |
- (1000180) | 1000180..1000260 | + | 81 | NuclAT_11 | - | - |
- (1000180) | 1000180..1000260 | + | 81 | NuclAT_11 | - | - |
- (1000180) | 1000180..1000260 | + | 81 | NuclAT_11 | - | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | gmhA/lpcA | 981391..997351 | 15960 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15559.90 Da Isoelectric Point: 6.9798
>T257220 WP_001263488.1 NZ_CP104114:995450-995848 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQEAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQEAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3P5GWS5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |