Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1028737..1029551 | Replicon | chromosome |
Accession | NZ_CP101388 | ||
Organism | Salmonella enterica strain SC2017167 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | NMU38_RS04955 | Protein ID | WP_000971655.1 |
Coordinates | 1028737..1029264 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | E8XL32 |
Locus tag | NMU38_RS04960 | Protein ID | WP_000855692.1 |
Coordinates | 1029261..1029551 (-) | Length | 97 a.a. |
Genomic Context
Location: 1026763..1027284 (522 bp)
Type: Others
Protein ID: WP_000858988.1
Type: Others
Protein ID: WP_000858988.1
Location: 1028459..1028664 (206 bp)
Type: Others
Protein ID: Protein_971
Type: Others
Protein ID: Protein_971
Location: 1030240..1030566 (327 bp)
Type: Others
Protein ID: WP_000393302.1
Type: Others
Protein ID: WP_000393302.1
Location: 1032951..1033601 (651 bp)
Type: Others
Protein ID: WP_001674874.1
Type: Others
Protein ID: WP_001674874.1
Location: 1024037..1026604 (2568 bp)
Type: Others
Protein ID: WP_001005807.1
Type: Others
Protein ID: WP_001005807.1
Location: 1027456..1028112 (657 bp)
Type: Others
Protein ID: WP_000420452.1
Type: Others
Protein ID: WP_000420452.1
Location: 1028737..1029264 (528 bp)
Type: Toxin
Protein ID: WP_000971655.1
Type: Toxin
Protein ID: WP_000971655.1
Location: 1029261..1029551 (291 bp)
Type: Antitoxin
Protein ID: WP_000855692.1
Type: Antitoxin
Protein ID: WP_000855692.1
Location: 1029821..1029999 (179 bp)
Type: Others
Protein ID: Protein_974
Type: Others
Protein ID: Protein_974
Location: 1030839..1031186 (348 bp)
Type: Others
Protein ID: WP_001669174.1
Type: Others
Protein ID: WP_001669174.1
Location: 1031171..1031620 (450 bp)
Type: Others
Protein ID: WP_000381610.1
Type: Others
Protein ID: WP_000381610.1
Location: 1032051..1032494 (444 bp)
Type: Others
Protein ID: WP_000715092.1
Type: Others
Protein ID: WP_000715092.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU38_RS04935 (1024037) | 1024037..1026604 | - | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
NMU38_RS04940 (1026763) | 1026763..1027284 | + | 522 | WP_000858988.1 | hypothetical protein | - |
NMU38_RS04945 (1027456) | 1027456..1028112 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
NMU38_RS04950 (1028459) | 1028459..1028664 | + | 206 | Protein_971 | IS5/IS1182 family transposase | - |
NMU38_RS04955 (1028737) | 1028737..1029264 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
NMU38_RS04960 (1029261) | 1029261..1029551 | - | 291 | WP_000855692.1 | DUF1778 domain-containing protein | Antitoxin |
NMU38_RS04965 (1029821) | 1029821..1029999 | - | 179 | Protein_974 | IS3 family transposase | - |
NMU38_RS04970 (1030240) | 1030240..1030566 | + | 327 | WP_000393302.1 | hypothetical protein | - |
NMU38_RS04975 (1030839) | 1030839..1031186 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
NMU38_RS04980 (1031171) | 1031171..1031620 | - | 450 | WP_000381610.1 | membrane protein | - |
NMU38_RS04985 (1032051) | 1032051..1032494 | - | 444 | WP_000715092.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
NMU38_RS04990 (1032951) | 1032951..1033601 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1028488..1038914 | 10426 | ||
flank | IS/Tn | - | - | 1028488..1028664 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T252098 WP_000971655.1 NZ_CP101388:c1029264-1028737 [Salmonella enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp