Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 961931..962556 | Replicon | chromosome |
Accession | NZ_CP101386 | ||
Organism | Salmonella enterica strain SC2017100 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | M7SD17 |
Locus tag | NMU37_RS04725 | Protein ID | WP_000911336.1 |
Coordinates | 962158..962556 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | M7S3S8 |
Locus tag | NMU37_RS04720 | Protein ID | WP_000557549.1 |
Coordinates | 961931..962158 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU37_RS04690 (956976) | 956976..958493 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
NMU37_RS04695 (958569) | 958569..959114 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
NMU37_RS04700 (959379) | 959379..960137 | + | 759 | WP_000244329.1 | amidase activator ActS | - |
NMU37_RS04710 (960422) | 960422..961228 | - | 807 | WP_010989071.1 | DUF1460 domain-containing protein | - |
NMU37_RS04715 (961503) | 961503..961754 | - | 252 | WP_001540858.1 | hypothetical protein | - |
NMU37_RS04720 (961931) | 961931..962158 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NMU37_RS04725 (962158) | 962158..962556 | + | 399 | WP_000911336.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
NMU37_RS04730 (963362) | 963362..963898 | + | 537 | WP_001038506.1 | STM3031 family outer membrane protein | - |
NMU37_RS04735 (963945) | 963945..964577 | + | 633 | WP_000835265.1 | YfdX family protein | - |
NMU37_RS04740 (965296) | 965296..965880 | + | 585 | WP_001244638.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 960422..971747 | 11325 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14938.30 Da Isoelectric Point: 7.2155
>T252077 WP_000911336.1 NZ_CP101386:962158-962556 [Salmonella enterica]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6IFC | |
PDB | 6IFM |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V2Y5V5 |