Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1076815..1077629 | Replicon | chromosome |
Accession | NZ_CP101382 | ||
Organism | Salmonella enterica strain SC2017030 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | NMU36_RS05185 | Protein ID | WP_000971655.1 |
Coordinates | 1076815..1077342 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | E8XL32 |
Locus tag | NMU36_RS05190 | Protein ID | WP_000855692.1 |
Coordinates | 1077339..1077629 (-) | Length | 97 a.a. |
Genomic Context
Location: 1074841..1075362 (522 bp)
Type: Others
Protein ID: WP_000858988.1
Type: Others
Protein ID: WP_000858988.1
Location: 1076537..1076742 (206 bp)
Type: Others
Protein ID: Protein_1017
Type: Others
Protein ID: Protein_1017
Location: 1078318..1078644 (327 bp)
Type: Others
Protein ID: WP_000393302.1
Type: Others
Protein ID: WP_000393302.1
Location: 1081029..1081679 (651 bp)
Type: Others
Protein ID: WP_001674874.1
Type: Others
Protein ID: WP_001674874.1
Location: 1072115..1074682 (2568 bp)
Type: Others
Protein ID: WP_001005807.1
Type: Others
Protein ID: WP_001005807.1
Location: 1075534..1076190 (657 bp)
Type: Others
Protein ID: WP_000420452.1
Type: Others
Protein ID: WP_000420452.1
Location: 1076815..1077342 (528 bp)
Type: Toxin
Protein ID: WP_000971655.1
Type: Toxin
Protein ID: WP_000971655.1
Location: 1077339..1077629 (291 bp)
Type: Antitoxin
Protein ID: WP_000855692.1
Type: Antitoxin
Protein ID: WP_000855692.1
Location: 1077899..1078077 (179 bp)
Type: Others
Protein ID: Protein_1020
Type: Others
Protein ID: Protein_1020
Location: 1078917..1079264 (348 bp)
Type: Others
Protein ID: WP_001669174.1
Type: Others
Protein ID: WP_001669174.1
Location: 1079249..1079698 (450 bp)
Type: Others
Protein ID: WP_000381610.1
Type: Others
Protein ID: WP_000381610.1
Location: 1080129..1080572 (444 bp)
Type: Others
Protein ID: WP_000715092.1
Type: Others
Protein ID: WP_000715092.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU36_RS05165 (1072115) | 1072115..1074682 | - | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
NMU36_RS05170 (1074841) | 1074841..1075362 | + | 522 | WP_000858988.1 | hypothetical protein | - |
NMU36_RS05175 (1075534) | 1075534..1076190 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
NMU36_RS05180 (1076537) | 1076537..1076742 | + | 206 | Protein_1017 | IS5/IS1182 family transposase | - |
NMU36_RS05185 (1076815) | 1076815..1077342 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
NMU36_RS05190 (1077339) | 1077339..1077629 | - | 291 | WP_000855692.1 | DUF1778 domain-containing protein | Antitoxin |
NMU36_RS05195 (1077899) | 1077899..1078077 | - | 179 | Protein_1020 | IS3 family transposase | - |
NMU36_RS05200 (1078318) | 1078318..1078644 | + | 327 | WP_000393302.1 | hypothetical protein | - |
NMU36_RS05205 (1078917) | 1078917..1079264 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
NMU36_RS05210 (1079249) | 1079249..1079698 | - | 450 | WP_000381610.1 | membrane protein | - |
NMU36_RS05215 (1080129) | 1080129..1080572 | - | 444 | WP_000715092.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
NMU36_RS05220 (1081029) | 1081029..1081679 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1076566..1086992 | 10426 | ||
flank | IS/Tn | - | - | 1076566..1076742 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T252058 WP_000971655.1 NZ_CP101382:c1077342-1076815 [Salmonella enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp