Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1027977..1028791 | Replicon | chromosome |
Accession | NZ_CP101376 | ||
Organism | Salmonella enterica strain SC2016091 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | NMU34_RS04950 | Protein ID | WP_000971655.1 |
Coordinates | 1027977..1028504 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | E8XL32 |
Locus tag | NMU34_RS04955 | Protein ID | WP_000855692.1 |
Coordinates | 1028501..1028791 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU34_RS04930 (1023277) | 1023277..1025844 | - | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
NMU34_RS04935 (1026003) | 1026003..1026524 | + | 522 | WP_000858988.1 | hypothetical protein | - |
NMU34_RS04940 (1026696) | 1026696..1027352 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
NMU34_RS04945 (1027699) | 1027699..1027904 | + | 206 | Protein_970 | IS5/IS1182 family transposase | - |
NMU34_RS04950 (1027977) | 1027977..1028504 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
NMU34_RS04955 (1028501) | 1028501..1028791 | - | 291 | WP_000855692.1 | DUF1778 domain-containing protein | Antitoxin |
NMU34_RS04960 (1029061) | 1029061..1029239 | - | 179 | Protein_973 | IS3 family transposase | - |
NMU34_RS04965 (1029480) | 1029480..1029806 | + | 327 | WP_000393302.1 | hypothetical protein | - |
NMU34_RS04970 (1030079) | 1030079..1030426 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
NMU34_RS04975 (1030411) | 1030411..1030860 | - | 450 | WP_000381610.1 | membrane protein | - |
NMU34_RS04980 (1031291) | 1031291..1031734 | - | 444 | WP_000715092.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
NMU34_RS04985 (1032191) | 1032191..1032841 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1027728..1038154 | 10426 | ||
flank | IS/Tn | - | - | 1027728..1027904 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T252012 WP_000971655.1 NZ_CP101376:c1028504-1027977 [Salmonella enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK9 | |
AlphaFold DB | A0A625WHV3 |