Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1682151..1682965 | Replicon | chromosome |
Accession | NZ_CP101375 | ||
Organism | Salmonella enterica strain SC2016090 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | NMU33_RS08240 | Protein ID | WP_000971655.1 |
Coordinates | 1682151..1682678 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | E8XL32 |
Locus tag | NMU33_RS08245 | Protein ID | WP_000855692.1 |
Coordinates | 1682675..1682965 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU33_RS08220 (1677451) | 1677451..1680018 | - | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
NMU33_RS08225 (1680177) | 1680177..1680698 | + | 522 | WP_000858988.1 | hypothetical protein | - |
NMU33_RS08230 (1680870) | 1680870..1681526 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
NMU33_RS08235 (1681873) | 1681873..1682078 | + | 206 | Protein_1609 | IS5/IS1182 family transposase | - |
NMU33_RS08240 (1682151) | 1682151..1682678 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
NMU33_RS08245 (1682675) | 1682675..1682965 | - | 291 | WP_000855692.1 | DUF1778 domain-containing protein | Antitoxin |
NMU33_RS08250 (1683235) | 1683235..1683413 | - | 179 | Protein_1612 | IS3 family transposase | - |
NMU33_RS08255 (1683654) | 1683654..1683980 | + | 327 | WP_000393302.1 | hypothetical protein | - |
NMU33_RS08260 (1684253) | 1684253..1684600 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
NMU33_RS08265 (1684585) | 1684585..1685034 | - | 450 | WP_000381610.1 | membrane protein | - |
NMU33_RS08270 (1685465) | 1685465..1685908 | - | 444 | WP_000715092.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
NMU33_RS08275 (1686365) | 1686365..1687015 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1681902..1692328 | 10426 | ||
flank | IS/Tn | - | - | 1681902..1682078 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T251995 WP_000971655.1 NZ_CP101375:c1682678-1682151 [Salmonella enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK9 | |
AlphaFold DB | A0A625WHV3 |