Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1534278..1534903 | Replicon | chromosome |
Accession | NZ_CP101375 | ||
Organism | Salmonella enterica strain SC2016090 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | M7SD17 |
Locus tag | NMU33_RS07580 | Protein ID | WP_000911336.1 |
Coordinates | 1534505..1534903 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | M7S3S8 |
Locus tag | NMU33_RS07575 | Protein ID | WP_000557549.1 |
Coordinates | 1534278..1534505 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU33_RS07545 (1529323) | 1529323..1530840 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
NMU33_RS07550 (1530916) | 1530916..1531461 | - | 546 | WP_000133994.1 | isopentenyl-diphosphate Delta-isomerase | - |
NMU33_RS07555 (1531726) | 1531726..1532484 | + | 759 | WP_000244329.1 | amidase activator ActS | - |
NMU33_RS07565 (1532769) | 1532769..1533575 | - | 807 | WP_010989071.1 | DUF1460 domain-containing protein | - |
NMU33_RS07570 (1533850) | 1533850..1534101 | - | 252 | WP_001540858.1 | hypothetical protein | - |
NMU33_RS07575 (1534278) | 1534278..1534505 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NMU33_RS07580 (1534505) | 1534505..1534903 | + | 399 | WP_000911336.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
NMU33_RS07585 (1535709) | 1535709..1536245 | + | 537 | WP_001038506.1 | STM3031 family outer membrane protein | - |
NMU33_RS07590 (1536292) | 1536292..1536924 | + | 633 | WP_000835265.1 | YfdX family protein | - |
NMU33_RS07595 (1537643) | 1537643..1538227 | + | 585 | WP_001244638.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 1532769..1544094 | 11325 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14938.30 Da Isoelectric Point: 7.2155
>T251994 WP_000911336.1 NZ_CP101375:1534505-1534903 [Salmonella enterica]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHAGSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6IFC | |
PDB | 6IFM |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6IFM | |
AlphaFold DB | A0A3V2Y5V5 |