Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1370889..1371703 | Replicon | chromosome |
Accession | NZ_CP101372 | ||
Organism | Salmonella enterica strain SC2016025 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | NMU31_RS06755 | Protein ID | WP_000971655.1 |
Coordinates | 1370889..1371416 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | E8XL32 |
Locus tag | NMU31_RS06760 | Protein ID | WP_000855692.1 |
Coordinates | 1371413..1371703 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NMU31_RS06735 (1366189) | 1366189..1368756 | - | 2568 | WP_001005807.1 | DNA mismatch repair protein MutS | - |
NMU31_RS06740 (1368915) | 1368915..1369436 | + | 522 | WP_000858988.1 | hypothetical protein | - |
NMU31_RS06745 (1369608) | 1369608..1370264 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
NMU31_RS06750 (1370611) | 1370611..1370816 | + | 206 | Protein_1331 | IS5/IS1182 family transposase | - |
NMU31_RS06755 (1370889) | 1370889..1371416 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
NMU31_RS06760 (1371413) | 1371413..1371703 | - | 291 | WP_000855692.1 | DUF1778 domain-containing protein | Antitoxin |
NMU31_RS06765 (1371973) | 1371973..1372151 | - | 179 | Protein_1334 | IS3 family transposase | - |
NMU31_RS06770 (1372392) | 1372392..1372718 | + | 327 | WP_000393302.1 | hypothetical protein | - |
NMU31_RS06775 (1372991) | 1372991..1373338 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
NMU31_RS06780 (1373323) | 1373323..1373772 | - | 450 | WP_000381610.1 | membrane protein | - |
NMU31_RS06785 (1374203) | 1374203..1374646 | - | 444 | WP_000715092.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
NMU31_RS06790 (1375103) | 1375103..1375753 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1370640..1381066 | 10426 | ||
flank | IS/Tn | - | - | 1370640..1370816 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T251952 WP_000971655.1 NZ_CP101372:c1371416-1370889 [Salmonella enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A625WHV3 |