Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1048669..1049483 | Replicon | chromosome |
Accession | NZ_CP100718 | ||
Organism | Salmonella enterica subsp. enterica serovar Weltevreden strain R17.4942 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | NL732_RS05070 | Protein ID | WP_000971655.1 |
Coordinates | 1048669..1049196 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | NL732_RS05075 | Protein ID | WP_000855694.1 |
Coordinates | 1049193..1049483 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NL732_RS05050 (1043971) | 1043971..1046538 | - | 2568 | WP_001005816.1 | DNA mismatch repair protein MutS | - |
NL732_RS05055 (1046696) | 1046696..1047217 | + | 522 | WP_015633084.1 | hypothetical protein | - |
NL732_RS05060 (1047388) | 1047388..1048044 | - | 657 | WP_000420451.1 | protein-serine/threonine phosphatase | - |
NL732_RS05065 (1048379) | 1048379..1048596 | + | 218 | Protein_993 | IS5/IS1182 family transposase | - |
NL732_RS05070 (1048669) | 1048669..1049196 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
NL732_RS05075 (1049193) | 1049193..1049483 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
NL732_RS05080 (1049752) | 1049752..1049930 | - | 179 | Protein_996 | IS3 family transposase | - |
NL732_RS05085 (1050171) | 1050171..1050497 | + | 327 | WP_000393302.1 | hypothetical protein | - |
NL732_RS05090 (1050770) | 1050770..1051117 | - | 348 | WP_001555786.1 | DUF1493 family protein | - |
NL732_RS05095 (1051102) | 1051102..1051551 | - | 450 | WP_000381608.1 | hypothetical protein | - |
NL732_RS05100 (1051983) | 1051983..1052426 | - | 444 | WP_000715096.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
NL732_RS05105 (1052882) | 1052882..1053532 | + | 651 | WP_023166786.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1048420..1058845 | 10425 | ||
flank | IS/Tn | - | - | 1048420..1048596 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T251196 WP_000971655.1 NZ_CP100718:c1049196-1048669 [Salmonella enterica subsp. enterica serovar Weltevreden]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10664.50 Da Isoelectric Point: 6.3133
>AT251196 WP_000855694.1 NZ_CP100718:c1049483-1049193 [Salmonella enterica subsp. enterica serovar Weltevreden]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |